SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30131
         (658 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    22   4.5  
DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex det...    22   5.9  
DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex det...    22   5.9  
DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex det...    22   5.9  
DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex det...    22   5.9  
DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex det...    22   5.9  
DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex det...    22   5.9  
DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex det...    22   5.9  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          22   5.9  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          22   5.9  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          22   5.9  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          22   5.9  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          22   5.9  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          22   5.9  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          22   5.9  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    22   5.9  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    22   5.9  

>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 10/37 (27%), Positives = 20/37 (54%)
 Frame = -1

Query: 550 QSSLFSSQSTYHSRSSNFKFTLYKSGIAYRNSDQTKL 440
           ++S   S  TY+S+ +  +FT Y    +    ++TK+
Sbjct: 376 RNSCLGSTETYYSKHNTQQFTQYIPESSSNLQEKTKI 412


>DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 137 MYRLRPPPNP 146


>DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 137 MYRLRPPPNP 146


>DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 137 MYRLRPPPNP 146


>DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 137 MYRLRPPPNP 146


>DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 137 MYRLRPPPNP 146


>DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 137 MYRLRPPPNP 146


>DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 137 MYRLRPPPNP 146


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 386 MYRLRPPPNP 395


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 386 MYRLRPPPNP 395


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 386 MYRLRPPPNP 395


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 386 MYRLRPPPNP 395


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 386 MYRLRPPPNP 395


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 386 MYRLRPPPNP 395


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 385 MYRLRPPPNP 394


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 370 MYRLRPPPNP 379


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 319 LYRPRPPPEP 290
           +YR RPPP P
Sbjct: 386 MYRLRPPPNP 395


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,137
Number of Sequences: 438
Number of extensions: 3853
Number of successful extensions: 18
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19734030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -