BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30130 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 24 1.4 AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 22 4.2 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 22 4.2 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 7.3 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 9.6 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 9.6 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 9.6 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/44 (20%), Positives = 24/44 (54%) Frame = -3 Query: 542 RCLMSGFSIFFSFLGWEHAFDDITTYIIFFAKVEQLTDFGSTFG 411 + + G ++ + + H F+ + Y ++ A + Q+++ +TFG Sbjct: 491 KTVSDGIRHYYVNVTFPHLFNGLVDYSLWKALIFQISNLQTTFG 534 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 9 MKLNVSYPATGCQKLFEVVDEHKLRI 86 M ++ P+TG Q + +VV HKL++ Sbjct: 54 MYIHPDSPSTGEQWMQKVVSFHKLKL 79 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 9 MKLNVSYPATGCQKLFEVVDEHKLRI 86 M ++ P+TG Q + +VV HKL++ Sbjct: 54 MYIHPDSPSTGEQWMQKVVSFHKLKL 79 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 447 LSKEDDVRRYVVKRVLPAKEGKENAK 524 L +E+D+ + +KRV KE N K Sbjct: 71 LDEENDINQGGLKRVSALKEKNPNLK 96 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -2 Query: 168 QRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGI 40 Q H H P IH P+L + +PP+ ++S I Sbjct: 88 QLHSHHGPPIHHQIRPPILHDTQPMCESLN--TQPPVTSSSNI 128 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -2 Query: 168 QRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGI 40 Q H H P IH P+L + +PP+ ++S I Sbjct: 88 QLHSHHGPPIHHQIRPPILHDTQPMCESLN--TQPPVTSSSNI 128 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -2 Query: 168 QRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGI 40 Q H H P IH P+L + +PP+ ++S I Sbjct: 88 QLHSHHGPPIHHQIRPPILHDTQPMCESLN--TQPPVTSSSNI 128 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,941 Number of Sequences: 336 Number of extensions: 3305 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -