BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30127 (723 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0694 - 5719188-5720400,5720439-5721194,5722004-5722247,572... 29 4.9 10_06_0018 - 9674771-9674995,9675079-9675126,9675471-9675530,967... 29 4.9 07_01_0794 - 6179424-6179714,6179797-6179844,6180189-6180248,618... 29 4.9 08_02_0431 + 17053928-17054189,17054296-17054564,17054661-170548... 28 6.5 11_06_0156 + 20748472-20748951 28 8.6 02_04_0488 + 23397480-23397687,23397777-23397805,23398462-233985... 28 8.6 >11_01_0694 - 5719188-5720400,5720439-5721194,5722004-5722247, 5723862-5723901 Length = 750 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/72 (26%), Positives = 38/72 (52%) Frame = +1 Query: 244 IYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEERNQAILDFVTKISVNTQTKDVA 423 ++ G G + N + + L +FLE+ + KST E R+ +++ + S+N + A Sbjct: 253 VHTGEGQSSSNLPLLEHAILDEFLELSRLENVKSTQEARSIKLIEKESINSLNLEWTGGA 312 Query: 424 QKNLFDKLNILG 459 + + D +N+LG Sbjct: 313 DRFVED-MNVLG 323 >10_06_0018 - 9674771-9674995,9675079-9675126,9675471-9675530, 9675693-9675758,9675844-9675906,9675985-9676032, 9676150-9676215,9676493-9676558,9676660-9676725, 9676822-9676887,9676975-9677058,9677310-9677654, 9677738-9677833,9678129-9678332,9678434-9678726, 9678833-9678958,9679217-9679226 Length = 643 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +1 Query: 178 NVDIDIDQDSNEFLNVDILVEKIYNG 255 N D+DID +SNE +VDI V ++ NG Sbjct: 25 NDDVDIDDESNEDTDVDINV-RVENG 49 >07_01_0794 - 6179424-6179714,6179797-6179844,6180189-6180248, 6180411-6180476,6180562-6180624,6180703-6180750, 6180868-6180933,6181031-6181096,6181230-6181295, 6181510-6181575,6181663-6181746,6181839-6181907, 6181998-6182342,6182426-6182521,6182615-6182707, 6182817-6183020,6183117-6183385,6183492-6183753 Length = 753 Score = 28.7 bits (61), Expect = 4.9 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = +1 Query: 178 NVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGIS-AKSTIE 354 N D+DID + NE +VDI V ++ NG T T ++ L K L + + + + Sbjct: 67 NDDVDIDDEGNEDTDVDINV-RVENGAPETRGKTKLKDVWNLPKGLRIVVQCNDLNQAVG 125 Query: 355 ERNQAILDFVTKISVN 402 E + + F+ IS N Sbjct: 126 EEDGILGKFLGMISRN 141 >08_02_0431 + 17053928-17054189,17054296-17054564,17054661-17054864, 17054974-17055066,17055160-17055255,17055339-17055683, 17055935-17056018,17056106-17056171,17056268-17056333, 17056436-17056501,17056635-17056700,17056798-17056863, 17056981-17057028,17057107-17057169,17057255-17057320, 17057483-17057542,17057888-17057935,17058019-17058255, 17058346-17058366 Length = 741 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +1 Query: 178 NVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEV 321 N D+DID + NE +VDI V ++ NG T T ++ L K L + Sbjct: 67 NDDVDIDDEGNEDTDVDINV-RVENGAPETRGKTKLKDVWNLPKGLRI 113 >11_06_0156 + 20748472-20748951 Length = 159 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 3 GRKRLRIKKY*KFIQAGKNMGEGRQEVKKIRGQGKKE 113 GR+RLR+++ AG + E ++I G+GK+E Sbjct: 77 GRQRLRLRELEGKAAAGHRLHETMSRRRRISGRGKRE 113 >02_04_0488 + 23397480-23397687,23397777-23397805,23398462-23398564, 23398811-23398982,23399380-23399440,23399757-23399889, 23400438-23400709,23400776-23400843,23401096-23401235, 23401413-23401499,23401580-23402088,23402173-23402990, 23403024-23403222,23403662-23403817 Length = 984 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +1 Query: 175 VNVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVEL 327 VN + ++ E +N+D + Y L+D ++D++KK K L L Sbjct: 536 VNGHFEEEECDEEIMNIDASSDSSLEPYDLSDDDSDLQKKFTQLKDLAAAL 586 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,099,066 Number of Sequences: 37544 Number of extensions: 225956 Number of successful extensions: 527 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -