BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30127 (723 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis def... 29 3.4 U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis def... 29 3.4 AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. 29 3.4 Z99278-1|CAB16490.1| 793|Caenorhabditis elegans Hypothetical pr... 29 4.4 >U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis defect protein 1, isoformb protein. Length = 1437 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/85 (21%), Positives = 42/85 (49%) Frame = +1 Query: 181 VDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEER 360 +D +D + + V +++ + NG D N ++ + + + + +++ ++ Sbjct: 450 IDFLESRDPKQGMYVLLMINMMING---VDRNISDDQMWTEETMWQARMRLRSEAAKDKL 506 Query: 361 NQAILDFVTKISVNTQTKDVAQKNL 435 ++ I F T +VN+Q +DVAQ L Sbjct: 507 HKYIEKFTTSETVNSQIRDVAQNML 531 >U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis defect protein 1, isoforma protein. Length = 1435 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/85 (21%), Positives = 42/85 (49%) Frame = +1 Query: 181 VDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEER 360 +D +D + + V +++ + NG D N ++ + + + + +++ ++ Sbjct: 450 IDFLESRDPKQGMYVLLMINMMING---VDRNISDDQMWTEETMWQARMRLRSEAAKDKL 506 Query: 361 NQAILDFVTKISVNTQTKDVAQKNL 435 ++ I F T +VN+Q +DVAQ L Sbjct: 507 HKYIEKFTTSETVNSQIRDVAQNML 531 >AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. Length = 1018 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/85 (21%), Positives = 42/85 (49%) Frame = +1 Query: 181 VDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEER 360 +D +D + + V +++ + NG D N ++ + + + + +++ ++ Sbjct: 33 IDFLESRDPKQGMYVLLMINMMING---VDRNISDDQMWTEETMWQARMRLRSEAAKDKL 89 Query: 361 NQAILDFVTKISVNTQTKDVAQKNL 435 ++ I F T +VN+Q +DVAQ L Sbjct: 90 HKYIEKFTTSETVNSQIRDVAQNML 114 >Z99278-1|CAB16490.1| 793|Caenorhabditis elegans Hypothetical protein Y53C12B.1 protein. Length = 793 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/45 (28%), Positives = 27/45 (60%) Frame = +1 Query: 322 ELGISAKSTIEERNQAILDFVTKISVNTQTKDVAQKNLFDKLNIL 456 ELG + + + + +L F K + N++T VAQ+ L++ ++I+ Sbjct: 699 ELGSAIRRLDTRQIEILLQFTVKWNTNSRTSSVAQRVLYEIVHIV 743 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,420,087 Number of Sequences: 27780 Number of extensions: 235720 Number of successful extensions: 636 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -