BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30126 (703 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0109 + 1338525-1338590,1338744-1339325 28 6.2 04_03_0453 - 16058125-16058407,16059104-16059507 28 8.3 >10_01_0109 + 1338525-1338590,1338744-1339325 Length = 215 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = -3 Query: 257 EGRRKNHRRHC--KKSCCNYWGGDD*EVSAINCRRNDKNCGKESVRKSREKSCRNCSNTN 84 EGR ++ + HC +K CN ++C + KN + + +SR++ R+ S + Sbjct: 142 EGRCEDEQTHCSKRKKPCN-----------VSCSKLSKNPSRVAGYRSRKEEPRHSSKKS 190 Query: 83 TNASGVCSRRSK 48 +S CS+++K Sbjct: 191 KPSSVPCSKQAK 202 >04_03_0453 - 16058125-16058407,16059104-16059507 Length = 228 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 321 AILKLTEPTEAIGFLPEAMSLPIFALDSKIPTGSFLAAETKPSV-IMPP 464 A+L+L A+ LPE + P ++ P LAA PS+ + PP Sbjct: 3 ALLQLAMSVAAVPHLPEEETTPSVDVEIASPDQQHLAAAAAPSMAVFPP 51 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,280,589 Number of Sequences: 37544 Number of extensions: 288421 Number of successful extensions: 819 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -