BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30124 (741 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 24 4.3 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 23 7.5 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 90 GFKGFFCTCNFREKDCVK 143 G KGF CT R K C+K Sbjct: 337 GHKGFECTGQDRSKLCIK 354 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.4 bits (48), Expect = 7.5 Identities = 7/33 (21%), Positives = 19/33 (57%) Frame = -1 Query: 249 YPRERLTQVLQTVELAPHLNLGRVYWHIRSEDY 151 +P + + L+ +EL H N+ ++ W+ ++ + Sbjct: 195 HPHKLIVMYLKYLELEKHQNMMQMAWNFMNDSF 227 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 686,662 Number of Sequences: 2352 Number of extensions: 12936 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -