BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30122 (722 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29097-10|AAA68414.1| 348|Caenorhabditis elegans Serpentine rec... 28 7.8 AF000265-7|AAB52941.1| 893|Caenorhabditis elegans Hypothetical ... 28 7.8 >U29097-10|AAA68414.1| 348|Caenorhabditis elegans Serpentine receptor, class a (alpha)protein 29 protein. Length = 348 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 569 ILFLLLPTCCSVVTGFYRYHDINAVSYL 486 I+FL+L C + F+ +HD + SY+ Sbjct: 147 IVFLILQIICPIAIQFWTFHDSDYTSYV 174 >AF000265-7|AAB52941.1| 893|Caenorhabditis elegans Hypothetical protein C18E3.3 protein. Length = 893 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 331 PEPLSDFYLHSQSCGPNDNSRRRPKHVISDPSDPLTV 221 P P+S F + G D++R P VIS P+ T+ Sbjct: 408 PRPISIFNNPRLNSGDEDSTRNSPSSVISPPTSVFTM 444 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,321,578 Number of Sequences: 27780 Number of extensions: 348646 Number of successful extensions: 879 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -