BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30122 (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 2.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 3.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 5.1 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 5.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 5.1 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.1 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 447 RKHNCSKLKILRIMVVVSIRPTSTYYKHVYKLQSSIFIHR 328 RK+ KLKI+ ++ + R S + ++LQ+ I + R Sbjct: 491 RKYAMLKLKIVLSTILRNFRVRSDVKESEFRLQADIILKR 530 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/34 (20%), Positives = 20/34 (58%) Frame = +1 Query: 553 NNKNRISFEKSGKTVVLKSSWPKG*DVRCIRIER 654 ++++R + + KTV+L + P+G + +++ Sbjct: 86 DSRDRSNTSNTSKTVILSNKGPEGIQINATELQK 119 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +1 Query: 553 NNKNRISFEKSGKTVVLKSSWPKG*DVRCIRIER 654 ++++R + + KTV+L P+G + +++ Sbjct: 86 DSRDRSNTSNTSKTVILSDKGPEGIQINATELQK 119 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +1 Query: 553 NNKNRISFEKSGKTVVLKSSWPKG*DVRCIRIER 654 ++++R + + KTV+L P+G + +++ Sbjct: 86 DSRDRSNASNTSKTVILSDKGPEGIQINATELQK 119 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 5.1 Identities = 6/34 (17%), Positives = 20/34 (58%) Frame = +1 Query: 553 NNKNRISFEKSGKTVVLKSSWPKG*DVRCIRIER 654 ++++R + + KT++L + P+G + +++ Sbjct: 86 DSRDRSNTSNTSKTIILSNKGPEGIQINATELQK 119 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +1 Query: 553 NNKNRISFEKSGKTVVLKSSWPKG*DVRCIRIER 654 ++++R + + KTV+L P+G + +++ Sbjct: 86 DSRDRSNASNTSKTVILSDKGPEGIQINATELQK 119 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,335 Number of Sequences: 438 Number of extensions: 4200 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -