BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30119 (673 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 2.3 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 6.9 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.0 bits (47), Expect = 2.3 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = -3 Query: 431 SFLFASTTRGNNFSLQ*ALNESRTAFSS---SWSCPSKLNGSTQS 306 SF+ +T LQ +NE + +S+ S SCP +GST S Sbjct: 344 SFVCVNTLVSEQEGLQ-LINEMKKRYSALINSQSCPITSSGSTDS 387 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 259 IRALSTTYSRNAKVTFDWVDPF 324 I+ L T +RN K W PF Sbjct: 379 IKILKTVSNRNDKGDIFWFSPF 400 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,375 Number of Sequences: 336 Number of extensions: 3400 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -