BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30119 (673 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.02 |ubr1|SPBC32F12.14|N-end-recognizing protein Ubr1|Sc... 27 1.9 SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyce... 27 2.5 SPAC8E11.04c |||phospholipase |Schizosaccharomyces pombe|chr 1||... 27 3.3 SPBC713.12 |erg1||squalene monooxygenase Erg1 |Schizosaccharomyc... 26 5.7 SPAC144.18 |||nucleotide sugar transporter |Schizosaccharomyces ... 25 9.9 SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21... 25 9.9 >SPBC19C7.02 |ubr1|SPBC32F12.14|N-end-recognizing protein Ubr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1958 Score = 27.5 bits (58), Expect = 1.9 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +1 Query: 304 FDWVDPFNLDGQLHDDEKAVRDSFRAYCNE--KLLPRVVEANRNEVFHREI 450 FD+VDPFN+ + E+A R Y + K L VV + + H I Sbjct: 923 FDYVDPFNIHYSRNQREEAENILRRRYSKQHSKHLESVVYEEYHPILHSNI 973 >SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 27.1 bits (57), Expect = 2.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 457 ELGELGALGCTIKGYGCAGVSYVTY 531 E GEL +GC +K +GC + Y Sbjct: 719 ETGELHIVGCRVKVFGCEPILQYVY 743 >SPAC8E11.04c |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 224 Score = 26.6 bits (56), Expect = 3.3 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 510 WSFLRYVWSHYKRTRW 557 WSF+ WS++K +W Sbjct: 33 WSFMANTWSNFKHIKW 48 >SPBC713.12 |erg1||squalene monooxygenase Erg1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 457 Score = 25.8 bits (54), Expect = 5.7 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -3 Query: 335 PSKLNGSTQSKVTFAFLEYVVDNALMLFDLYIVES--IYLEVNDTIITHI 192 PS L G + + +YV+ +L + I+ES I+L+ + II +I Sbjct: 402 PSHLIGHFYAVCLYGIYQYVLSGPALLMPVRIIESLLIFLQASLVIIPYI 451 >SPAC144.18 |||nucleotide sugar transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 25.0 bits (52), Expect = 9.9 Identities = 8/18 (44%), Positives = 16/18 (88%) Frame = +1 Query: 187 HCICVIMVSLTSKYILST 240 +C+ I+++LT+KY+LS+ Sbjct: 20 YCMASILMTLTNKYVLSS 37 >SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 25.0 bits (52), Expect = 9.9 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = -3 Query: 563 STPSSSLVMRPYVT*ETPAHP*PLMVQ-----PRAPNSPSSL*ISLWNTSFLFASTTR 405 S+P S+ + P T TP PL+ + P P S S +S N FL +S+ R Sbjct: 37 SSPGSTRLTTPRTTARTPLASSPLLFESSSPGPNIPQSSRSHLLSQRNDLFLDSSSQR 94 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,726,824 Number of Sequences: 5004 Number of extensions: 56995 Number of successful extensions: 137 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -