BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30117 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) 146 1e-35 SB_34113| Best HMM Match : PSD5 (HMM E-Value=3.3) 31 0.58 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) 30 1.8 SB_58044| Best HMM Match : Vitellogenin_N (HMM E-Value=0.022) 30 1.8 SB_31131| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 30 1.8 SB_18023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_46097| Best HMM Match : zf-CCHC (HMM E-Value=7.2e-05) 29 3.1 SB_34460| Best HMM Match : Borrelia_orfA (HMM E-Value=0.3) 29 4.1 SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) 29 4.1 SB_11431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) 28 5.4 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 5.4 SB_48653| Best HMM Match : ABC_membrane (HMM E-Value=0.34) 28 7.1 SB_39652| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 28 7.1 SB_5737| Best HMM Match : DED (HMM E-Value=2.9e-18) 28 7.1 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 146 bits (355), Expect = 1e-35 Identities = 73/115 (63%), Positives = 87/115 (75%) Frame = +1 Query: 280 MRGIKGLVWETSVLDADEGIRFRGLSIPECQQQLPKAKGGEEPLPEGLFWLLVTGDIPTE 459 MRGIKGLV ETS+LD +E LPKA GG+EPLPEG+FWLL+TG+IPT+ Sbjct: 1 MRGIKGLVTETSLLDPEE--------------LLPKADGGKEPLPEGIFWLLMTGEIPTK 46 Query: 460 AQAKALSKEWAARAELPAHVVTMLNNMPGKLHPMSQFSAAVTALNSESKFAKAYS 624 Q LSKEWAA+A+LP HVV MLNN P LHPMSQFSAA+TA+N+ESKF +AY+ Sbjct: 47 QQVDNLSKEWAAKADLPQHVVQMLNNFPDTLHPMSQFSAAITAMNTESKFVQAYN 101 >SB_34113| Best HMM Match : PSD5 (HMM E-Value=3.3) Length = 851 Score = 31.5 bits (68), Expect = 0.58 Identities = 36/139 (25%), Positives = 55/139 (39%), Gaps = 4/139 (2%) Frame = +1 Query: 109 ACPTATVLLRGLSAEQTNLKSILQEKIPKEQEKIREFRKKHGSTKVGEVTVDMMYGGMRG 288 AC V RG +QTNL+ + + P+E + RK+ +++ T D G Sbjct: 4 ACALDLVHDRGRRFDQTNLRPMAEVSFPRELQPSEIQRKEASASRESVQTSDSESPAQEG 63 Query: 289 IKGLVWETSVLDADEGIRFRGLSIPECQQQ----LPKAKGGEEPLPEGLFWLLVTGDIPT 456 + + S A EG R S + Q + E P EG + T D + Sbjct: 64 RQSIQTSDSESPAQEGRRSVHSSDSDSPAQEGRLSVQTSDSESPAQEGRL-SVQTSDSES 122 Query: 457 EAQAKALSKEWAARAELPA 513 AQ LS + + +E PA Sbjct: 123 PAQEGRLSVQ-TSDSESPA 140 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 136 RGLSAEQTNLKSILQEKIPKEQEKIREFRKKHGSTKV 246 RGL E+ +L+ +LQE K + +E ++ HG K+ Sbjct: 544 RGLKVEKEDLERVLQEAGEKVASQQKELKEAHGQRKL 580 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 359 MDRPRKRIPSSASSTEVSQTRPLIPRMPPYIIS 261 M P + + ++A+ TE++ T+PL+P P ++S Sbjct: 366 MPAPTESVVTTATPTEIAVTKPLLPPKPSGLVS 398 >SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) Length = 1338 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 181 EKIPKEQEKIREFRKKHGSTKVGEVTVD 264 E+I QEKI+E RK +GS K T+D Sbjct: 924 ERIRLLQEKIKEMRKLYGSLKAEVATID 951 >SB_58044| Best HMM Match : Vitellogenin_N (HMM E-Value=0.022) Length = 1671 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 310 TSVLDADEGIRFRGLSIPECQQQLPKAKGG 399 +S+ DA IRF LS+PE + + PK+ G Sbjct: 872 SSIFDALRNIRFPRLSLPELEGRFPKSSPG 901 >SB_31131| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) Length = 407 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 359 MDRPRKRIPSSASSTEVSQTRPLIPRMPPYIIS 261 M P + + ++A+ TE++ T+PL+P P ++S Sbjct: 118 MPAPTESVVTTATPTEIAVTKPLLPPKPSGLVS 150 >SB_18023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 500 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 151 EQTNLKSILQEKIPKEQEKIREFRKKHGSTKVGEVTVDMMYGGMRGIKGLVWETSVLDAD 330 E L I + + E RE K + G ++ + +GL W+ S D D Sbjct: 131 EHCRLMGIAVQYLINEGHNFRESDKICMKYEAGPCLGPVLDDTVLRARGLPWQAS--DQD 188 Query: 331 EGIRFRGLSIPECQQQL 381 FRGL+IP C ++ Sbjct: 189 VANFFRGLNIPSCVSRM 205 >SB_46097| Best HMM Match : zf-CCHC (HMM E-Value=7.2e-05) Length = 430 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 256 TVDMMYGGMRG-IKGLVWETSVLDADEGIRFRGLSIPECQQQLPKAKGGEEPLPE 417 TVD++Y +RG LV + LD E ++F L +CQ P A+ + LP+ Sbjct: 254 TVDLLYLFVRGDFTPLVSCDACLDL-EVLQFMNLDFIQCQPTAPDAQDSKHTLPD 307 >SB_34460| Best HMM Match : Borrelia_orfA (HMM E-Value=0.3) Length = 1102 Score = 28.7 bits (61), Expect = 4.1 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = +1 Query: 43 RSAALKMALFRITSSRLVELQKACPTATVLLRGLSAEQTNLKSILQEKIPKEQEKIREFR 222 +S ++ + + SS L+ + K T T + L+ E T LK L+ EQ+ Sbjct: 801 KSEMMEKKMQDMASSSLM-MNKVITTTTDSINDLNEEMTELKIQLETGFETEQDLRTSLN 859 Query: 223 KKHGSTKVGE 252 + G K+GE Sbjct: 860 QAEGRIKLGE 869 >SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) Length = 976 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 166 KSILQEKIPKEQEKIREFRKKHGSTK 243 K +++EK P E++K E +KKH S K Sbjct: 109 KKVIKEKDPSEKKKDGESKKKHRSEK 134 >SB_11431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 109 ACPTATVLLRGLSAEQTNLKSILQEKIPKEQEKIREFRKKHGSTKVGEV 255 AC V RG +QTNL+ + + P+E + I E ++K T G + Sbjct: 4 ACALDLVHDRGRRFDQTNLRPMAEVSFPRELQPI-EIQRKEACTGPGMI 51 >SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) Length = 1745 Score = 28.3 bits (60), Expect = 5.4 Identities = 19/83 (22%), Positives = 39/83 (46%) Frame = +1 Query: 4 RSRASCRDLCGSLRSAALKMALFRITSSRLVELQKACPTATVLLRGLSAEQTNLKSILQE 183 RSRAS R L L S+ + +++ S +C TA++ A Q+ + + +E Sbjct: 402 RSRASWRRLTDVLGSSMVSLSVATTPCSSWARFVFSCMTASISATDPIASQSVISHVSRE 461 Query: 184 KIPKEQEKIREFRKKHGSTKVGE 252 + + ++ I+ + +K G+ Sbjct: 462 REDRLEQGIQSENMRKLRSKAGD 484 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +1 Query: 67 LFRITSSRLVELQKACPTA-TVLLRGLSAEQTNLKSILQEKIPKEQEKIR 213 L + R+ EL+ A A + + G+ A++ + K++ EKI KE+EK++ Sbjct: 297 LIQTLQKRIKELESAGTQAGSKIDTGMGAKRKDSKAVDPEKIAKEKEKLQ 346 >SB_48653| Best HMM Match : ABC_membrane (HMM E-Value=0.34) Length = 264 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = -1 Query: 185 FSWRILFKFVC----SALRPRSRTVAVGHAFCNSTSLEDVIL 72 F W +L FV S + PRSR G C STS+ ++L Sbjct: 135 FDWMLLTCFVIDKLESMITPRSRAAWAGLMKCPSTSISGIML 176 >SB_39652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 37 SLRSAALKMALFRITSSRLVELQKACPTATVLLR 138 SLR A+ ++ RI S +V L+KA +LLR Sbjct: 33 SLRKASERVVNLRIASESMVNLRKASERMVILLR 66 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 27.9 bits (59), Expect = 7.1 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -1 Query: 356 DRPRKRIPSSASSTEVSQTRPLIPRMPPYIISTVTSPTLVEPCF 225 D+P IPS SST S MPP +ST T P P F Sbjct: 789 DQPIPAIPSLMSSTLTSSISTTSTGMPPASLSTPT-PFFTHPGF 831 >SB_5737| Best HMM Match : DED (HMM E-Value=2.9e-18) Length = 1719 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 361 PECQQQLPKAKGGEEPLPEGLFWLLVTGDIPTEAQAKALSKEWAAR 498 P C+ LPK +G +P G W+LV G+ +A K+ W ++ Sbjct: 568 PACRM-LPK-EGEPISIPNGTPWILVEGNSAIQANPKSKINCWISK 611 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 27.5 bits (58), Expect = 9.4 Identities = 31/114 (27%), Positives = 45/114 (39%), Gaps = 2/114 (1%) Frame = +1 Query: 76 ITSSRLVELQKACPTATVLLRGLSAEQTNLKSILQEKIPKEQEKIREFRKKHGSTKVGEV 255 + SS+L K T L+ E NLK LQ+K+ + ++ E R K+ Sbjct: 1896 LDSSKLKTEAKILREETERLKAQLEETMNLKEELQDKLHTAEHELFEARTSEEKAKIEHR 1955 Query: 256 TVDMMYGGMRG-IKGLVWET-SVLDADEGIRFRGLSIPECQQQLPKAKGGEEPL 411 D+ +R K E L A+E R S + Q QL KA + L Sbjct: 1956 DKDIELAALRKYFKDTESELHRKLTAEESARL--ASENQLQNQLSKASTAVDDL 2007 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.130 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,885,158 Number of Sequences: 59808 Number of extensions: 376908 Number of successful extensions: 1300 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1299 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -