BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30113 (727 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0686 + 20697493-20697927 49 4e-06 07_01_0154 - 1094256-1094672,1094954-1094977,1095867-1095891,109... 28 8.7 >07_03_0686 + 20697493-20697927 Length = 144 Score = 48.8 bits (111), Expect = 4e-06 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 4/123 (3%) Frame = +2 Query: 212 KDFNDVLDDIVLGEEKES----KSSYDEGFRAGIEAGNIEGYHLGYHRGAELGRELGFYW 379 KD D L+ VL +E K+ Y EG +G E EG +G G ++G ELGFY Sbjct: 6 KDDFDFLEPSVLLDETHYQTGFKNGYSEGLVSGKE----EGRQVGLKNGFQVGEELGFYQ 61 Query: 380 STVNECLELNETSDAKLSEKIIAQLLKVKELIDTFPPNNSEDHDILGMADAVRAQYKKAC 559 ++ L S ++ + ++ L+ ++P +N ED + + + +R +++ Sbjct: 62 GCLDVWTSLVSIDQDAFSARVRKNIEQLAALLRSYPLSNPEDEQVQDIMEKIRLKFRVIT 121 Query: 560 ALL 568 A L Sbjct: 122 ASL 124 >07_01_0154 - 1094256-1094672,1094954-1094977,1095867-1095891, 1096014-1096304,1096391-1096470,1096953-1097052, 1097143-1097204,1097650-1097750,1097940-1098117, 1098298-1098924,1099014-1099100,1099804-1099905, 1100265-1100348,1100580-1100657 Length = 751 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -2 Query: 573 IFNKAQAFLYCALTASAIPSMS--WSSELLGGKV 478 +FN L L +S I SM W+SEL+GGK+ Sbjct: 423 LFNVLLQLLDAPLISSKIDSMENRWASELIGGKL 456 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,874,463 Number of Sequences: 37544 Number of extensions: 281080 Number of successful extensions: 676 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -