BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30107 (778 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 27 0.65 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 24 4.6 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 27.1 bits (57), Expect = 0.65 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -3 Query: 323 TTLHGWRKSWKVDLYM*W*TRIIPHLN 243 TT+ W++ W ++ W R+IP +N Sbjct: 849 TTMERWQREWDESVHGRWTYRLIPDVN 875 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 24.2 bits (50), Expect = 4.6 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 288 NLPALSPTMESGSIVSWEKKEGDKLSEGDLLCEIETDK 401 ++ A+ T + + V W+K G+ L + +I TDK Sbjct: 81 DIAAIGITNQRETTVVWDKNTGEPLYNAIVWNDIRTDK 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,239 Number of Sequences: 2352 Number of extensions: 14648 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -