BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30106 (592 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q039J2 Cluster: Predicted acyltransferase; n=2; Lactoba... 32 8.7 >UniRef50_Q039J2 Cluster: Predicted acyltransferase; n=2; Lactobacillus|Rep: Predicted acyltransferase - Lactobacillus casei (strain ATCC 334) Length = 664 Score = 32.3 bits (70), Expect = 8.7 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 Query: 284 GLITPRVMTSQYPQVFRQNVRITLHXQLFASLIYVYXY 397 GLIT T+ Y +F QN+ LH + +L+YVY + Sbjct: 89 GLITVLFGTAAYITLFSQNLLHNLHMMVLTNLLYVYNW 126 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,743,634 Number of Sequences: 1657284 Number of extensions: 10371019 Number of successful extensions: 23331 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23322 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41073165837 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -