BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30106 (592 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0931 - 21647562-21649037 28 6.4 08_02_0849 - 21841470-21841883,21843748-21843813,21844768-218449... 27 8.5 >10_08_0931 - 21647562-21649037 Length = 491 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -1 Query: 328 HLRIL*RHDPWSDESGXRDRVTPLPPSSTPIHMK*PYASL 209 H +L PW SG D P PPS +P + P +SL Sbjct: 210 HETVLPSPIPWRSRSGRFDASAPSPPSPSPKRLS-PASSL 248 >08_02_0849 - 21841470-21841883,21843748-21843813,21844768-21844951, 21845427-21847468,21848544-21848870 Length = 1010 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 13 WPVSSSTHLSNKNKTQTDDSTNDTFDDGWMIF 108 WPV + L N T+ + TND+FDD W F Sbjct: 467 WPVGNINELHN---TKVVNETNDSFDD-WQDF 494 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,808,035 Number of Sequences: 37544 Number of extensions: 288236 Number of successful extensions: 645 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -