BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30106 (592 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_40921| Best HMM Match : Choline_kin_N (HMM E-Value=2.8) 28 5.0 >SB_49215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Frame = -2 Query: 309 VMTLGVMSPVXGTESPPFPPHLPQYT*S---DLTRLCS*TKNR--PSQSHVRKAVDVTKT 145 ++TLG V G++ P P H+P T S D TR+ + R Q H + D+ +T Sbjct: 272 IITLGAKGSVIGSQQNPMPLHIP-VTPSEAVDTTRIYRDLERRIWAHQRHTKTKTDIKET 330 Query: 144 RR 139 R Sbjct: 331 SR 332 >SB_40921| Best HMM Match : Choline_kin_N (HMM E-Value=2.8) Length = 351 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -1 Query: 268 VTPLPPSSTPIHMK*PYASL*LNKKQAISITRAQGRRCNKNTS 140 VT LPP TP + P ++ ++KQ+ + T +RCN+ S Sbjct: 296 VTQLPPKPTPYNWTAPTLTVPAHRKQSTAFT---PKRCNQRPS 335 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,438,281 Number of Sequences: 59808 Number of extensions: 343046 Number of successful extensions: 784 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -