BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30104 (680 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0697 - 5948664-5948770,5949077-5949563 29 3.4 01_07_0248 + 42261373-42261609,42261733-42261905,42261986-422620... 28 7.9 >12_01_0697 - 5948664-5948770,5949077-5949563 Length = 197 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/86 (22%), Positives = 37/86 (43%) Frame = +3 Query: 72 DLSLGQLTYRDIVLYKINEYKYGFPFIVRTSEIEYPEPGQQNFAYISAIYVKDHYTDGNG 251 D+ + + + Y I+E + F + + + +P + N ++ +Y K H DG Sbjct: 34 DMDVNMVCMLPMEFYAIDEAEVA-QFSLGPKDAVFEKPDESN-RHMKPLYFKGHI-DGKP 90 Query: 252 GYPIVKSGGVGQKFVKLKLKSQRGHG 329 ++ GG F+ L + GHG Sbjct: 91 VSRMLVDGGAAMNFMPYSLFKKLGHG 116 >01_07_0248 + 42261373-42261609,42261733-42261905,42261986-42262058, 42262148-42262282,42262352-42262562,42262886-42263034, 42263169-42263267,42263821-42263989,42264176-42264308, 42264600-42264694,42264774-42264882,42265136-42265295, 42265433-42265594,42265814-42265985,42266254-42266402, 42266914-42266951,42267779-42267839,42267913-42268155, 42268233-42268315,42269521-42269609,42270449-42270495, 42270576-42270656,42270737-42270899,42271077-42271267, 42271691-42271762 Length = 1097 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 56 QRPKPRPKSRPADLPRHRLVQDQRIQI--RLPVHCPNER 166 QR +P P+ +PA PR R ++RI+ R P P R Sbjct: 1007 QRREPSPRRKPASPPRKRTPPNRRIESPRRQPDPSPRRR 1045 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,124,800 Number of Sequences: 37544 Number of extensions: 289116 Number of successful extensions: 987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 986 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -