BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30101 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 32 0.021 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 32 0.021 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 29 0.19 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 29 0.19 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 29 0.19 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 29 0.19 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 29 0.19 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 29 0.19 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 28 0.25 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 28 0.25 AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-tran... 27 0.44 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 27 0.77 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 24 5.4 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 31.9 bits (69), Expect = 0.021 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 258 EASEKFKEVNRAHTILSDATKRNIYDNYG 344 EA +F E+ +++ +LSD+ +R +D YG Sbjct: 1 EAETRFVEIKQSYELLSDSERRRAFDQYG 29 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 31.9 bits (69), Expect = 0.021 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 258 EASEKFKEVNRAHTILSDATKRNIYDNYG 344 EA +F E+ +++ +LSD+ +R +D YG Sbjct: 1 EAETRFVEIKQSYELLSDSERRRAFDQYG 29 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 270 KFKEVNRAHTILSDATKRNIYDNYG 344 +F E+ +++ +LSD+ +R +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 28.3 bits (60), Expect = 0.25 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +3 Query: 219 ALKYHPDKNHNSPEASEKFKEVN--RAHTILSDATKRNIYDNYGSLGLYIAEQFGEENVN 392 A K H + +SP+ EK +N ++TI S+ R+ + Y + +A G ++ Sbjct: 306 AKKQHQQQQRSSPQPPEKMPRLNPPSSNTIQSELLARSGFQPYRPVDERLAHPAGAFPID 365 Query: 393 AY 398 AY Sbjct: 366 AY 367 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 28.3 bits (60), Expect = 0.25 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 246 HNSPE--ASEKFKEVNRAHTILSDATKRNIYDNYGSLGLYIAEQFGEEN 386 HN E A++ F +N HT+L K D Y GLY +N Sbjct: 401 HNQLEIIAADTFSPMNNLHTLLLSHNKLKYLDAYSLNGLYALSLLSLDN 449 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -2 Query: 685 AGFSEAPEDDGAGMAIGGACSPVGRPSTLGCDVTG 581 +G S+ P +G G G + S P TLG D G Sbjct: 1410 SGRSKPPGPEGVGGGGGKSPSDKHNPGTLGTDSRG 1444 >AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-transferase D10 protein. Length = 211 Score = 27.5 bits (58), Expect = 0.44 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = +3 Query: 210 RKLALKYH-PDKNHNSPEASEKFKEVNRAHTILSDATKRN-IYDNYGSLGLYIAEQFG 377 +KL + + + N + PE E+ ++ N HTI + + I+++Y ++ +Y+ E++G Sbjct: 20 KKLGITFDLKEVNPHLPEVREQLRKFNPQHTIPTFIEDGHVIWESY-AIAIYLVEKYG 76 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 26.6 bits (56), Expect = 0.77 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +3 Query: 216 LALKYHPDKNHNSPEASEKFKEVNRAHTILSDATKRNIYDNYGSLG 353 + L YH +HNSP + F ++ A T + + N N + G Sbjct: 452 MPLPYHDHNHHNSPMSPINFNLLSAASTAVPNPAATNATANSTTTG 497 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 23.8 bits (49), Expect = 5.4 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 210 RKLALKY-HPDKNHNSPEASEKFKEVNRAHTILSDATKRNI-YDNYGSLGLYIAEQF 374 R L L++ H + P E K+VN HTI + +I +++Y L +Y+AE++ Sbjct: 20 RHLGLEFNHIVTSIYDPADFEVLKKVNPQHTIPTLVDNGHILWESYAIL-IYLAEKY 75 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,421 Number of Sequences: 2352 Number of extensions: 13279 Number of successful extensions: 65 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -