BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30100 (740 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0448 - 34005581-34005655,34005735-34005830,34006669-340076... 30 2.2 >03_06_0448 - 34005581-34005655,34005735-34005830,34006669-34007616, 34007684-34007851,34007908-34008099,34008164-34008346, 34008414-34008590,34008667-34012074 Length = 1748 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = -1 Query: 680 GRRAYDPSNGEWLPSLMGVSNVRGRAKLEEGRTCHSAREI 561 GR A DP N W PS G+ +EE R HS R I Sbjct: 1535 GRYASDPVNTSWQPSKF------GKPGMEESRRTHSGRSI 1568 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,197,271 Number of Sequences: 37544 Number of extensions: 384473 Number of successful extensions: 802 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -