Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30100
         (740 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0448 - 34005581-34005655,34005735-34005830,34006669-340076...    30   2.2  

>03_06_0448 - 34005581-34005655,34005735-34005830,34006669-34007616,
            34007684-34007851,34007908-34008099,34008164-34008346,
            34008414-34008590,34008667-34012074
          Length = 1748

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 17/40 (42%), Positives = 19/40 (47%)
 Frame = -1

Query: 680  GRRAYDPSNGEWLPSLMGVSNVRGRAKLEEGRTCHSAREI 561
            GR A DP N  W PS        G+  +EE R  HS R I
Sbjct: 1535 GRYASDPVNTSWQPSKF------GKPGMEESRRTHSGRSI 1568


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,197,271
Number of Sequences: 37544
Number of extensions: 384473
Number of successful extensions: 802
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 801
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1957111448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)