BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30100 (740 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113522-1|AAM29527.1| 658|Drosophila melanogaster RE60337p pro... 29 5.0 AE013599-89|AAF57326.2| 658|Drosophila melanogaster CG11665-PA ... 29 5.0 AY089607-1|AAL90345.1| 539|Drosophila melanogaster RE21692p pro... 29 8.8 AE014296-2102|AAF49952.1| 539|Drosophila melanogaster CG5642-PA... 29 8.8 >AY113522-1|AAM29527.1| 658|Drosophila melanogaster RE60337p protein. Length = 658 Score = 29.5 bits (63), Expect = 5.0 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 250 IVCLC*YFFYCSLGEICAYRSIKYNHNSV 336 I LC YF Y SLG + + S+KY++ +V Sbjct: 97 IPALC-YFLYSSLGPVSSILSVKYSYRTV 124 >AE013599-89|AAF57326.2| 658|Drosophila melanogaster CG11665-PA protein. Length = 658 Score = 29.5 bits (63), Expect = 5.0 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 250 IVCLC*YFFYCSLGEICAYRSIKYNHNSV 336 I LC YF Y SLG + + S+KY++ +V Sbjct: 97 IPALC-YFLYSSLGPVSSILSVKYSYRTV 124 >AY089607-1|AAL90345.1| 539|Drosophila melanogaster RE21692p protein. Length = 539 Score = 28.7 bits (61), Expect = 8.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 253 QFLIYSQFDNRRQEQKFDNK*YACVCASNTWHVVCVM 143 QF ++Q+ R E+ D CV SN W ++C++ Sbjct: 163 QFQNFAQYRARLTEKSQDEIQQLCVNHSNEWSILCIL 199 >AE014296-2102|AAF49952.1| 539|Drosophila melanogaster CG5642-PA protein. Length = 539 Score = 28.7 bits (61), Expect = 8.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 253 QFLIYSQFDNRRQEQKFDNK*YACVCASNTWHVVCVM 143 QF ++Q+ R E+ D CV SN W ++C++ Sbjct: 163 QFQNFAQYRARLTEKSQDEIQQLCVNHSNEWSILCIL 199 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,590,788 Number of Sequences: 53049 Number of extensions: 670291 Number of successful extensions: 1419 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1419 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3355404063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -