BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30094 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0050 + 18665251-18665613,18667280-18667744,18668548-186690... 31 0.66 05_06_0241 - 26634632-26636263 28 8.1 >11_05_0050 + 18665251-18665613,18667280-18667744,18668548-18669037, 18669115-18669143 Length = 448 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 255 ADYSPNPDHAGASHRRRPXHVLTDPSDPITF 347 AD PNP A SH + HV + P P+ F Sbjct: 132 ADICPNPQPAYMSHPKPNPHVFSSPCSPVVF 162 >05_06_0241 - 26634632-26636263 Length = 543 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = +3 Query: 123 PWFVRNVDLHDDLGLESIRKYMKSASERYFDKAMRHDNRLIVAAADYSPNPDHAGASHRR 302 P + R+V LH + K + + +R AMR+ I D + D AG + RR Sbjct: 104 PRYHRSVQLHKTIAYNGDAKALVATIKRQERLAMRNMAASIGCFLDADDSHDRAGRARRR 163 Query: 303 R 305 R Sbjct: 164 R 164 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,115,802 Number of Sequences: 37544 Number of extensions: 325859 Number of successful extensions: 869 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 869 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -