BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30092 (560 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_13793| Best HMM Match : Helicase_C (HMM E-Value=5.6) 29 2.6 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.4 SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) 29 3.4 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_16551| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_51901| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_44999| Best HMM Match : RepA_N (HMM E-Value=1.9) 27 7.9 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 31.1 bits (67), Expect = 0.64 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +3 Query: 360 QRFTNGGNKLVNINLSDSDQLLSYSNVLGDLDI-PKVKKQSLQHLKSSVEEDFQFLSELA 536 QRFT NK+V + LS + ++ Y L +LD+ + +Q L+ +E E Sbjct: 2053 QRFTGELNKIVLLLLSLTQRMHRYEKTLSELDMSEEADRQQRDILQEKIEYVKNQYEEAC 2112 Query: 537 ALKAVTEK 560 +K V +K Sbjct: 2113 KIKEVNDK 2120 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 31.1 bits (67), Expect = 0.64 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 7/99 (7%) Frame = +3 Query: 207 DPFNTPEAVVEVYISGISSLGSSADFKSKKYPLVVDEYEPDTFDVLKHRINQR--FTNG- 377 DP + + VY+ + S ++ FK + Y + + E+ P TF V+K R +NG Sbjct: 1251 DPVDPRWSAAVVYVEVLDSNDNAPVFKKQSYVVEMVEHSPTTFTVVKVEATDRDVGSNGR 1310 Query: 378 -GNKLVNINLSDSDQLLSYSNVL---GDLDIPKVKKQSL 482 +V+ N+ + + S S V+ D+D K+++ L Sbjct: 1311 ISYSIVSGNVDGAFVIDSSSGVIKPAQDIDREKIQRYLL 1349 >SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +3 Query: 84 PESLSFSGSSKTFESLLKEIFSASLGLSVEENSEWNGLLITDPFNTPE 227 PE S SGS + L FS ++ S +E+ W LL+TD +N P+ Sbjct: 405 PEMNSSSGSPSCLDVL--SCFSVNVASS-KESKFWCELLVTDKYNAPD 449 >SB_13793| Best HMM Match : Helicase_C (HMM E-Value=5.6) Length = 146 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +3 Query: 342 LKHRINQRFTNGGNKLVNINLSDSDQLLSYSNVLGDLDIPKVKKQSLQHLK 494 L+HR+ FT G+ VNIN+SD + + +VLG+ I + + L L+ Sbjct: 53 LRHRMGF-FTKSGD--VNINVSDVNNIAFSRSVLGNPTISRARGYQLHQLE 100 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 28.7 bits (61), Expect = 3.4 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +3 Query: 282 FKSKKYPLVVDEYEPDTFDVLKHRINQRFTNGGNKLVNINLSDSDQLLSYSNVL 443 FKS K P ++DE + D+LK + +F + +N DSD++ + +L Sbjct: 1017 FKSTKNPPLIDELKDFEDDMLKMIQSVKFIEASSPFLNKLKEDSDRIKNKPKLL 1070 >SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) Length = 672 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = -3 Query: 192 HSIRSSLQRKGQEKQKIFLLKDSRKFYWNQRNLTTQDYGGCLVR 61 H+I S++Q G + + +K + W++ ++T ++GG L++ Sbjct: 374 HNIVSTIQCAGNRRSDMNRVKKVKGLDWSEGAISTAEWGGALLK 417 >SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -2 Query: 169 TERPREAENISFKRLSKVLLEPEKLNDSGLWRMLSSPEAL-IPIIEEIKK 23 T RP+ A+ + +RL +V+ P+K+ND +S EA I +++ +++ Sbjct: 314 TSRPKFADIV--RRLDEVIRSPDKMNDEFAGSRISRAEATNIAMVKSVEE 361 >SB_16551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 267 GSSADFKSKKYPLVVDEYEPDTFDVLKHRINQRFTNGGNKLVNI 398 GS+ D + ++ +++D EP+T ++ + +I GGN++ +I Sbjct: 279 GSAEDVQKAEH-IIMDMIEPETVELKESQIGMVIGKGGNRINSI 321 >SB_51901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 27.5 bits (58), Expect = 7.9 Identities = 21/73 (28%), Positives = 34/73 (46%) Frame = +3 Query: 93 LSFSGSSKTFESLLKEIFSASLGLSVEENSEWNGLLITDPFNTPEAVVEVYISGISSLGS 272 L FS +S+T+ S I A+L ++E ++ P N+ + +SG SLG Sbjct: 311 LIFSTASQTWSSGFSSIMCATLEHYLDE------FILAGPANSQYCAATLSLSGSVSLGV 364 Query: 273 SADFKSKKYPLVV 311 S +YP V+ Sbjct: 365 PLHPASIRYPSVI 377 >SB_44999| Best HMM Match : RepA_N (HMM E-Value=1.9) Length = 402 Score = 27.5 bits (58), Expect = 7.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 281 ISGTPQTGYATNVNFDNCFRSV 216 ISG PQ G+A ++ NCF+++ Sbjct: 230 ISGDPQQGHAVFISAINCFQNI 251 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,385,107 Number of Sequences: 59808 Number of extensions: 292868 Number of successful extensions: 965 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 965 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -