BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30092 (560 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 28 0.24 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 25 1.7 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 24 3.9 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 23 5.2 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 6.8 AY146726-1|AAO12086.1| 136|Anopheles gambiae odorant-binding pr... 23 6.8 AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 23 6.8 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 23 6.8 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 9.0 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 9.0 AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. 23 9.0 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 27.9 bits (59), Expect = 0.24 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 267 GSSADFKSKKYPLVVDEYEPDTFDVL--KHRINQRFTNGGNKLVNINLSDSDQLLSY 431 GSS+ P VDE+E + ++L KH+ N R + +LVNI L +L Y Sbjct: 76 GSSSPHAPNGTP-PVDEHERELINMLEQKHKQNYRILDLEARLVNITLEKLCELCKY 131 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 25.0 bits (52), Expect = 1.7 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = -2 Query: 481 KDCFLTFGISKSPNTFEYDKS*SESLKLIFTSLLPPLVKR*L-ILC---FNTSKVSGSYS 314 K+C I KSP+ YD + ++LK L+ P+ K+ + +LC F+ S G+ Sbjct: 45 KNCSYVRKILKSPDFSHYDTTYLDTLKC--GDLMVPMRKKPIPLLCCPKFSNSPTCGAQQ 102 Query: 313 STTKGYF 293 + YF Sbjct: 103 LADRIYF 109 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.8 bits (49), Expect = 3.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 98 FLWFQ*NFRESFKRNIFCF 154 + W NFR+ FK+ + CF Sbjct: 380 YAWLNDNFRKEFKQVLPCF 398 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 23.4 bits (48), Expect = 5.2 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%) Frame = +3 Query: 108 SSKTFESLLKEIFSASLGLSVEENSEWNGLLITDPFNTPEAVVEVYISGISSLGSSADFK 287 +SK +ES L +F+A V E L +D +A+ + G + A Sbjct: 195 ASKDYESYLGALFAADAFHVVYEADGKTPLNESDV----KALYTTMLDGAGAYFQRALLT 250 Query: 288 -SKKYPL-VVDEYEPDTFDVLKHRI 356 + +Y L ++DE+ P FD+L RI Sbjct: 251 GANRYDLFLLDEHHPQLFDLLFDRI 275 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 23.0 bits (47), Expect = 6.8 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = +3 Query: 42 IGINASGELSILHSP-ESLSFSGSSKTFESLLKEIFSASLGLSVEENSEWNGLLITDPFN 218 I + G L + P L F G LLK I S SL + ++ + G ++D F+ Sbjct: 79 IFLKTDGSLLWKNKPVRELLFEGVKDPLLDLLKTINSTSLNIPFDKFGWFVGRNLSDTFD 138 Query: 219 TPEAVVEVYISGISSLG 269 + G+ S+G Sbjct: 139 -GTFTMRTGADGLESMG 154 >AY146726-1|AAO12086.1| 136|Anopheles gambiae odorant-binding protein AgamOBP19 protein. Length = 136 Score = 23.0 bits (47), Expect = 6.8 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = -2 Query: 541 KAASSLRNWKSSSTEDFKCCKDCFLTFGISKSPNTFEYDKS 419 + A ++ + T+DFKC C L Y+KS Sbjct: 42 EVADAVNRGVFADTKDFKCYVSCLLDIMQVARKGKVNYEKS 82 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 23.0 bits (47), Expect = 6.8 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 265 RLDMPLM*TSTTASGVLNGSVINNPFH 185 +LDM + ST A GV GS+ N H Sbjct: 274 KLDMVHVQNSTLAGGVAVGSICNLLIH 300 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 229 ASGVLNGSVINNPF 188 A VLNG +INNP+ Sbjct: 134 ALAVLNGYLINNPY 147 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 22.6 bits (46), Expect = 9.0 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 402 LSDSDQLLSYSNVLGDLDIPKVKKQSLQHLKSSVEEDFQFLSELAALKAVTE 557 LS+ L++ NV+ + L+ L++S+EE + AL A T+ Sbjct: 309 LSELQAKLAWRNVIDQEEQLAAVDDELKKLRTSIEEQEHRIRNREALVAKTD 360 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 22.6 bits (46), Expect = 9.0 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 183 RSSLQRKGQEKQKIFLLKDSRKFYWNQRNLTTQDY 79 RSS KG Q+ + + N+R L TQ+Y Sbjct: 392 RSSRSTKGVPPQRFRETTGMVRIFLNERILITQEY 426 >AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 22.6 bits (46), Expect = 9.0 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 183 RSSLQRKGQEKQKIFLLKDSRKFYWNQRNLTTQDY 79 RSS KG Q+ + + N+R L TQ+Y Sbjct: 162 RSSRSTKGVPPQRFRETTGMVRIFLNERILITQEY 196 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 522,685 Number of Sequences: 2352 Number of extensions: 9543 Number of successful extensions: 26 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -