BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30089 (563 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: L... 40 0.053 UniRef50_P41754 Cluster: Putative cutinase; n=1; Phytophthora ca... 34 2.0 UniRef50_Q7R8W9 Cluster: Regulator of chromosome condensation, p... 32 8.1 >UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: Like moricin - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 248 Score = 39.5 bits (88), Expect = 0.053 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +1 Query: 10 MGDGNHSPSGGPYAGLPASA 69 MGDGNHSPSG PYA LP A Sbjct: 1 MGDGNHSPSGRPYASLPTRA 20 >UniRef50_P41754 Cluster: Putative cutinase; n=1; Phytophthora capsici|Rep: Putative cutinase - Phytophthora capsici Length = 210 Score = 34.3 bits (75), Expect = 2.0 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -1 Query: 254 CRLQEQ*ETNRSEAI*WPTPVNIFVECLSSLSIANLCVLSMYDLYPP 114 CR + E S + W T N+F+ CL L + L V M+D++ P Sbjct: 68 CRRYQHGEAVASSSTRWRTKWNLFIICLLLLCLPGLAVRYMHDMFSP 114 >UniRef50_Q7R8W9 Cluster: Regulator of chromosome condensation, putative; n=2; Plasmodium (Vinckeia)|Rep: Regulator of chromosome condensation, putative - Plasmodium yoelii yoelii Length = 870 Score = 32.3 bits (70), Expect = 8.1 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -3 Query: 426 LKLRHLITVELNT-ENKILKIICTSLYLL*INRLNFINVW 310 L ++LI + +N NKI KI+C + Y+L +N L ++ W Sbjct: 711 LNKKYLIPININICVNKITKIVCGNDYVLALNDLGYVYGW 750 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 516,523,105 Number of Sequences: 1657284 Number of extensions: 9202572 Number of successful extensions: 13933 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13933 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37904934977 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -