BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30089 (563 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16G5.18 |erg24||C-14 sterol reductase Erg24|Schizosaccharomy... 26 3.3 SPCC18.04 |pof6||F-box protein Pof6|Schizosaccharomyces pombe|ch... 25 7.7 >SPBC16G5.18 |erg24||C-14 sterol reductase Erg24|Schizosaccharomyces pombe|chr 2|||Manual Length = 424 Score = 26.2 bits (55), Expect = 3.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 393 NTENKILKIICTSLYLL*INRLNFINVWFLKI 298 N+ IL ++CTS+YLL + + FI FL++ Sbjct: 108 NSACLILGVVCTSIYLLGASCMEFIWDNFLQL 139 >SPCC18.04 |pof6||F-box protein Pof6|Schizosaccharomyces pombe|chr 3|||Manual Length = 872 Score = 25.0 bits (52), Expect = 7.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 326 FNLFIYNK*RLVHMIFNILFSVFSSTV 406 ++LFI N +H+ +NIL SV + T+ Sbjct: 298 YSLFISNNLEEIHINWNILESVVNDTI 324 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,198,939 Number of Sequences: 5004 Number of extensions: 41269 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -