BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30088 (630 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 4.6 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.0 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.8 bits (49), Expect = 4.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 313 VTIAYFSVAGLDVLGSISAISLDLRS 390 VTIA FS+ LDV I+ LD+ S Sbjct: 764 VTIAIFSMTLLDVFTRIATPKLDVPS 789 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 8.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 412 RLQVHPDKETGDMSLCGFQGSSTINIRLDPDNN 510 R +V P K+ D+ Q SSTI++ DNN Sbjct: 158 RKRVRPLKKQLDLEAAWMQPSSTISLVERYDNN 190 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,263 Number of Sequences: 2352 Number of extensions: 13128 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -