BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30086 (500 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11410.1 68417.m01839 short-chain dehydrogenase/reductase (SD... 28 4.1 At4g31970.1 68417.m04545 cytochrome P450 family protein similar ... 27 7.1 At3g59000.1 68416.m06576 F-box family protein contains F-box dom... 27 7.1 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) /... 27 9.4 At4g33300.1 68417.m04737 disease resistance protein (CC-NBS-LRR ... 27 9.4 >At4g11410.1 68417.m01839 short-chain dehydrogenase/reductase (SDR) family protein contains INTERPRO family IPR002198 Short-chain dehydrogenase/reductase (SDR) superfamily Length = 317 Score = 27.9 bits (59), Expect = 4.1 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +3 Query: 264 LEELAYVRLDENTAEKVFINRAKRILIVSSDGHLAXWRCAPTFESAN 404 L L R+ + +E NR RI+IVSS+GH +R F+ N Sbjct: 144 LTNLLLERMKKTASES---NREGRIVIVSSEGHRFAYREGVQFDKIN 187 >At4g31970.1 68417.m04545 cytochrome P450 family protein similar to cytochrome P450 82C1 (CYP82C1p)(GI:2739004) [Glycine max]; flavonoid 3 ,5'-hydroxylase, Campanula medium, PATCHX:D1003951 Length = 523 Score = 27.1 bits (57), Expect = 7.1 Identities = 17/72 (23%), Positives = 29/72 (40%) Frame = +3 Query: 30 DLFSKKTAMSKRTVLNENYKGIVESMSIPAEIHERNGKKYASVGSILPIHCCPPEELERR 209 DL+S + + K +E MS+ + GK+Y GS+ P + + Sbjct: 161 DLYSLWVKKGGSEPVMVDLKSWLEDMSLNMMVRMVAGKRYFGGGSLSPEDAEEARQCRKG 220 Query: 210 AESTHHYCGVFT 245 + H G+FT Sbjct: 221 VANFFHLVGIFT 232 >At3g59000.1 68416.m06576 F-box family protein contains F-box domain Pfam:PF00646 Length = 491 Score = 27.1 bits (57), Expect = 7.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +3 Query: 213 ESTHHYCGVFTDELLA--PLEELAYVRLDENTAEKVFINRAKRILIVSSDGHL 365 +S Y F LLA LEEL V ++ ++ N + + L + SDGHL Sbjct: 170 DSVWFYVDKFETLLLALPALEELVLVDVNWLDSDVTISNASLKTLTIDSDGHL 222 >At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) / protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 Length = 1168 Score = 26.6 bits (56), Expect = 9.4 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +3 Query: 267 EELAYVRLDENT---AEKVFINRAKRILIVSSDGHLAXWRCAPTFESANRXIAGTP 425 + LA + D+N+ A+ V +N A+ SS+ ++ W+ P+ NR + TP Sbjct: 379 QNLAGKQDDQNSNSGADGVEVNTARSTDSTSSNFRMSSWKKLPSAAEKNRSLNNTP 434 >At4g33300.1 68417.m04737 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 816 Score = 26.6 bits (56), Expect = 9.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 99 ESMSIPAEIHERNGKKYASVGSILPIHCCPPE 194 E ++P EI E G KY + + + C P E Sbjct: 716 ELKTLPGEICELPGLKYLDISQCVSLSCLPEE 747 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,295,796 Number of Sequences: 28952 Number of extensions: 162076 Number of successful extensions: 438 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -