BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= maV30085
(312 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 0.37
DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 20 8.0
DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 20 8.0
>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
protein.
Length = 1770
Score = 24.2 bits (50), Expect = 0.37
Identities = 10/31 (32%), Positives = 17/31 (54%)
Frame = +1
Query: 148 STANTYLSVAKVVFTTLTKLSRKISHLL*HH 240
ST + + + + L K +R ++HLL HH
Sbjct: 738 STIQSLMKLKSPEWKDLAKKARSVNHLLTHH 768
>DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein.
Length = 135
Score = 19.8 bits (39), Expect = 8.0
Identities = 5/10 (50%), Positives = 9/10 (90%)
Frame = -2
Query: 50 DENIMNFVQC 21
DEN++ F++C
Sbjct: 56 DENVLLFIEC 65
>DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein.
Length = 135
Score = 19.8 bits (39), Expect = 8.0
Identities = 5/10 (50%), Positives = 9/10 (90%)
Frame = -2
Query: 50 DENIMNFVQC 21
DEN+ ++V+C
Sbjct: 56 DENVQSYVEC 65
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,481
Number of Sequences: 438
Number of extensions: 1424
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used: 6595479
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)
- SilkBase 1999-2023 -