BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30082 (453 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 1.6 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 1.6 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 24 2.2 AY994091-1|AAX86004.1| 83|Anopheles gambiae hyp6.3 precursor p... 23 3.8 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 23 5.0 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 6.7 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 22 8.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 22 8.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 22 8.8 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 168 CDPWRYPRVDCAIVPASPTAGTTGG 94 C P Y R+ VPA+ + TTGG Sbjct: 1857 CGPC-YQRISSMTVPATSSVSTTGG 1880 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 168 CDPWRYPRVDCAIVPASPTAGTTGG 94 C P Y R+ VPA+ + TTGG Sbjct: 1858 CGPC-YQRISSMTVPATSSVSTTGG 1881 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 24.2 bits (50), Expect = 2.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 271 RACLDPTLPYCNLGECSATP 330 R+ P P +LGECSA+P Sbjct: 25 RSSKTPRSPPSDLGECSASP 44 >AY994091-1|AAX86004.1| 83|Anopheles gambiae hyp6.3 precursor protein. Length = 83 Score = 23.4 bits (48), Expect = 3.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 40 VIIALCITLAVASAVPQP 93 V+IAL AV+ A+PQP Sbjct: 8 VLIALFAVFAVSQALPQP 25 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 23.0 bits (47), Expect = 5.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 120 RLEQWRSQPLDTSMD 164 R W+S+PLD S+D Sbjct: 398 REHYWQSRPLDASLD 412 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 22.6 bits (46), Expect = 6.7 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +1 Query: 199 CTTIGSTCLDCTTKQVCTKVGG 264 C +G CT++ C K GG Sbjct: 688 CGVVGHMAKVCTSQPKCLKCGG 709 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 22.2 bits (45), Expect = 8.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 193 PTAGTRERMRSMEVSKG*LRHCSSLPNRRHHRW 95 PTA T +R + S LR PN +H ++ Sbjct: 45 PTASTDQRAKRSSASMPKLRFEPPSPNEQHAQY 77 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.2 bits (45), Expect = 8.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 295 EESGPDTPSVYLLLLYKLAW*CNLGKY 215 + G S+YL+L +L C LG Y Sbjct: 2177 DSQGRPLKSLYLMLELRLPLVCRLGTY 2203 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.2 bits (45), Expect = 8.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 295 EESGPDTPSVYLLLLYKLAW*CNLGKY 215 + G S+YL+L +L C LG Y Sbjct: 2178 DSQGRPLKSLYLMLELRLPLVCRLGTY 2204 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 472,157 Number of Sequences: 2352 Number of extensions: 9036 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -