BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30081 (610 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||... 27 2.1 SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual 27 2.8 SPAC29E6.10c ||SPAC30.14c|kinetochore protein |Schizosaccharomyc... 26 3.7 SPBC19C7.06 |||proline-tRNA ligase |Schizosaccharomyces pombe|ch... 26 3.7 >SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 3227 Score = 27.1 bits (57), Expect = 2.1 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 401 IYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEERNQAILDFV 541 I+ Y L ++ DI + + K ++EL + S + NQ + DF+ Sbjct: 1201 IFQAYLLKEMPNDIVSQFEMLKSKQIELTVQMASYEGDLNQNLCDFL 1247 >SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 26.6 bits (56), Expect = 2.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 316 FSCPFSLVSFCHLFQASFFPWPLIFLTSCLPS 221 F+ F+ V+F + + +F W L+FL LP+ Sbjct: 722 FAQTFAFVTFNKVCTSQYFMWYLVFLPLVLPN 753 >SPAC29E6.10c ||SPAC30.14c|kinetochore protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1085 Score = 26.2 bits (55), Expect = 3.7 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 Query: 389 LLKKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEERNQAILDFVTKISVNTQT 568 LL N LN DI + +V+ + +++EE+N +FVT IS QT Sbjct: 361 LLSIPLNNVPSKSLNDDITQDELNSSNADVDEEVIETTSLEEKNVDNQEFVTSISNGNQT 420 >SPBC19C7.06 |||proline-tRNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 716 Score = 26.2 bits (55), Expect = 3.7 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +2 Query: 425 DLNTDIEKKIALQKFLEVELGISAKSTIEERNQAILDFVTKISVNTQTKDV 577 D + IAL + + V GI+ K+T +ERN+ I F +K++ D+ Sbjct: 487 DKGLKLPPAIALVQSVVVPCGITNKTTDQERNE-IEGFCSKLADRLNAADI 536 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,540,067 Number of Sequences: 5004 Number of extensions: 27150 Number of successful extensions: 81 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -