Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30080
         (674 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK128416-1|BAC87430.1|  303|Homo sapiens protein ( Homo sapiens ...    33   0.93 

>AK128416-1|BAC87430.1|  303|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46559 fis, clone THYMU3040126. ).
          Length = 303

 Score = 33.1 bits (72), Expect = 0.93
 Identities = 18/65 (27%), Positives = 30/65 (46%)
 Frame = -2

Query: 589 LCI*VEVLLTRAINQSTYAIQNTCRFSKCIFHENFLHNYVHVNVIVKHCILNVALI*HSL 410
           +C+ V +     +   TY    TC +  CI+   ++H +V+V V +  CI       H  
Sbjct: 7   MCVYVHIYTCIYVYTHTYIYTYTCMYV-CIYSHTYIHTHVYVCVHIHICI-------HMY 58

Query: 409 CCLYT 395
            C+YT
Sbjct: 59  MCVYT 63


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 70,960,519
Number of Sequences: 237096
Number of extensions: 1176389
Number of successful extensions: 1596
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1535
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1596
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7615267504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)