BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30070 (560 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0321 + 24091997-24092530 32 0.27 01_01_0459 + 3400288-3400729,3400760-3400806,3401055-3401141,340... 27 7.7 >05_05_0321 + 24091997-24092530 Length = 177 Score = 32.3 bits (70), Expect = 0.27 Identities = 19/76 (25%), Positives = 37/76 (48%) Frame = +2 Query: 47 ESDPRNPTASSC*KTRCGESQRGKEAKSETPKAGQGRRLKMKLKSTDRSVKGSSKNLKPS 226 E+ P++SS + E+ ++ + + A + RRL+ + + S GS + + Sbjct: 78 ENGQARPSSSSE-QEEAAEAASRRQQQQQAAAAARERRLRRRRSDSRGSCGGSGDGVLLN 136 Query: 227 TWVPGKVLRPRSMPRP 274 +VPG + R + PRP Sbjct: 137 FYVPGLLTRSMTTPRP 152 >01_01_0459 + 3400288-3400729,3400760-3400806,3401055-3401141, 3401230-3401561,3401648-3401807,3402155-3402223, 3403165-3403263 Length = 411 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 113 GKEAKSETPKAGQGRRLKMKLKSTDR 190 G+EAK E QG+RLK+ + DR Sbjct: 315 GREAKEELTMLVQGKRLKISVYGNDR 340 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,285,614 Number of Sequences: 37544 Number of extensions: 210946 Number of successful extensions: 512 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -