BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30068 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 25 0.82 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 25 0.82 AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin prot... 24 1.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.6 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 24.6 bits (51), Expect = 0.82 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 164 GNYILHYIGETPGLYGVGFMVRKNLADNIEELRGISERIAILNIK 298 G ILHY + PGL + + K +A ++L G + IL K Sbjct: 129 GALILHYYSDRPGLEHIVIGIVKTVA---KKLHGTDIEMRILKTK 170 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 24.6 bits (51), Expect = 0.82 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 164 GNYILHYIGETPGLYGVGFMVRKNLADNIEELRGISERIAILNIK 298 G ILHY + PGL + + K +A ++L G + IL K Sbjct: 129 GALILHYYSDRPGLEHIVIGIVKTVA---KKLHGTDIEMRILKTK 170 >AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin protein. Length = 124 Score = 23.8 bits (49), Expect = 1.4 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = +2 Query: 383 KIENFYNDLQSTMESAHKNKIVMGDFNGQIGTQKNGEEYIIGRYGFGFRSKNGTRIS 553 K + ND+++ + NK F G G + + ++ R GF+ G +IS Sbjct: 68 KKNSIINDVKNELFPEDINKRAPMGFQGMRGKKASFDDEYYKRAPMGFQGMRGKKIS 124 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 470 IGTQKNGEEYIIGRY 514 I Q+NG++ +GRY Sbjct: 363 INIQENGDQVSVGRY 377 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,909 Number of Sequences: 438 Number of extensions: 3610 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -