BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30065 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45330.1 68416.m04894 lectin protein kinase family protein co... 35 0.060 At2g16890.2 68415.m01944 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.10 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 33 0.24 At5g25820.1 68418.m03064 exostosin family protein contains Pfam ... 32 0.42 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 0.97 At1g61080.1 68414.m06877 proline-rich family protein 30 1.3 At2g17550.1 68415.m02031 expressed protein 29 2.2 At5g43560.2 68418.m05326 meprin and TRAF homology domain-contain... 29 3.0 At5g43560.1 68418.m05325 meprin and TRAF homology domain-contain... 29 3.0 At3g51290.1 68416.m05614 proline-rich family protein 29 3.9 At5g66640.1 68418.m08399 LIM domain-containing protein-related c... 28 5.2 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 28 5.2 At2g19860.1 68415.m02322 hexokinase 2 (HXK2) identical to hexoki... 28 5.2 At5g37600.1 68418.m04529 glutamine synthetase, putative similar ... 28 6.8 At3g12200.1 68416.m01521 protein kinase family protein contains ... 28 6.8 At5g24350.1 68418.m02870 expressed protein weak similarity to ne... 27 9.0 At4g23300.1 68417.m03358 protein kinase family protein contains ... 27 9.0 At4g00560.3 68417.m00079 methionine adenosyltransferase regulato... 27 9.0 At4g00560.2 68417.m00078 methionine adenosyltransferase regulato... 27 9.0 At4g00560.1 68417.m00077 methionine adenosyltransferase regulato... 27 9.0 At3g23530.1 68416.m02961 cyclopropane fatty acid synthase, putat... 27 9.0 At3g23510.1 68416.m02960 cyclopropane fatty acid synthase, putat... 27 9.0 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 27 9.0 >At3g45330.1 68416.m04894 lectin protein kinase family protein contains Serine/Threonine protein kinases active-site signature, Prosite:PS00108; contains Pfam profiles PF00069: Protein kinase domain, PF00139: Legume lectins beta domain, PF00138: Legume lectins alpha domain Length = 682 Score = 34.7 bits (76), Expect = 0.060 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +3 Query: 261 KHQRWPKPPELSP---IYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNLSVPSSDT 425 +HQR P+ +P + PV +P +TS ++T + SGP SP+S N S+ S T Sbjct: 618 RHQRLPEFSPNTPGIGVSTPVLMGLPSLAITSSSVTSSVSGPSASPSSANNSMFISHT 675 >At2g16890.2 68415.m01944 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 478 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/51 (33%), Positives = 31/51 (60%) Frame = -3 Query: 502 QGWSDRVSELTRVSDELIDKIQVLSHVSEEGTERLSEAGEVSGPDAVCVRV 350 +G++DR+ E + + +D+ ++LSH S +G LS G S +++CV V Sbjct: 326 EGFNDRIRESGMIVRDWVDQWEILSHESVKGF--LSHCGWNSAQESICVGV 374 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 32.7 bits (71), Expect = 0.24 Identities = 29/88 (32%), Positives = 37/88 (42%), Gaps = 1/88 (1%) Frame = +3 Query: 276 PKPPELSPIYLPVSPVMPVQPLTS-LTLTQTASGPETSPASDNLSVPSSDTWDKT*ILSI 452 P PP SP P PV P+ P TS + T S E+ S + P+ D+ D Sbjct: 811 PPPPVFSP---PPKPVTPLPPATSPMANAPTPSSSESGEISTPVQAPTPDSEDIEAPSDS 867 Query: 453 NSSLTLVNSDTLSDQPWVVPEVEESMTS 536 N S +S S P PEVE + S Sbjct: 868 NHSPVFKSSPAPS--PDSEPEVEAPVPS 893 >At5g25820.1 68418.m03064 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 654 Score = 31.9 bits (69), Expect = 0.42 Identities = 29/115 (25%), Positives = 48/115 (41%), Gaps = 2/115 (1%) Frame = +3 Query: 66 APTLHHR*PSINTVIMKFHATLMMEKLVP*SHVHG-TTSMTPTKASPSSTFKRS*RTWPA 242 APT + + P +N ++K HAT P + + G S+ A+ + +S P Sbjct: 113 APTANAKAPGLNPSLVKDHATAPSPSANPPAALPGLNPSLVKENATAPAPSVKSPVALPI 172 Query: 243 RATMQVKHQRW-PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNL 404 VK P +P+ LP + P + + TL T+ PE +P N+ Sbjct: 173 LNPSTVKENATAPVASAKAPVALP--SINPSPVMKNETLPTTSKVPERNPTKKNV 225 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 30.7 bits (66), Expect = 0.97 Identities = 23/75 (30%), Positives = 38/75 (50%) Frame = +3 Query: 171 TTSMTPTKASPSSTFKRS*RTWPARATMQVKHQRWPKPPELSPIYLPVSPVMPVQPLTSL 350 ++S++P+ +SPS + + P+ A P P LSP P P PL+SL Sbjct: 24 SSSLSPSSSSPSLSPSPP-SSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSS-SPLSSL 81 Query: 351 TLTQTASGPETSPAS 395 + + + S P +SP+S Sbjct: 82 SPSLSPSPPSSSPSS 96 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +3 Query: 237 PARATMQVKHQRWPKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSP 389 P A M +KH P PP L P +P+ P P S P P Sbjct: 462 PPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPP 512 >At2g17550.1 68415.m02031 expressed protein Length = 765 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -3 Query: 481 SELTRVSDELIDKIQVLSHVSEEGTERLSEAGEVSGPDAVCVR 353 +EL R +EL ++QV + V EE + + ++ PD V VR Sbjct: 546 NELRRQINELESEVQVRTPVEEEPIQEIETIVDLGNPDKVFVR 588 >At5g43560.2 68418.m05326 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1055 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 276 PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNLSVPS 416 P PP P+ P+ P P+ S T TAS + ++ L P+ Sbjct: 759 PAPPMSRPLSAPIIPPTQAAPVISAVQTSTASLARSMSSTGRLGSPT 805 >At5g43560.1 68418.m05325 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1055 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 276 PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNLSVPS 416 P PP P+ P+ P P+ S T TAS + ++ L P+ Sbjct: 759 PAPPMSRPLSAPIIPPTQAAPVISAVQTSTASLARSMSSTGRLGSPT 805 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = +3 Query: 276 PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNLSVPSSDTWD 431 P PP P P P+ P T+ T T T+S P P S TWD Sbjct: 74 PPPPPPRP---PPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWD 122 >At5g66640.1 68418.m08399 LIM domain-containing protein-related contains low similarity to Pfam profile PF00412: LIM domain Length = 450 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -2 Query: 200 RCFC--RCHRRSPMHVRLRN*LFHHQCRVEFH 111 RC C CHR MH L+ FH C E++ Sbjct: 95 RCLCCFHCHRPFVMHEILKKGKFHIDCYKEYY 126 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 28.3 bits (60), Expect = 5.2 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +3 Query: 282 PPELSPIYLPVSP-VMP--VQPLTSLTLTQTASGPETSPASDNLSVP 413 PP P Y P +P V P VQP T T T P TSP + P Sbjct: 100 PPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPP 146 >At2g19860.1 68415.m02322 hexokinase 2 (HXK2) identical to hexokinase 2 [Arabidopsis thaliana] Swiss-Prot:P93834 Length = 502 Score = 28.3 bits (60), Expect = 5.2 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +2 Query: 212 VQEILKDMASQGDYASQASAVAQTA-GIIAHLSAGIPGDACAAANVINSYTDGVRSGNFA 388 V EILK A + D A+ + + Q A + + AG+ + + ++ SY D + SG+ Sbjct: 37 VIEILK--AFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPSGDET 94 Query: 389 GFRQSL 406 GF +L Sbjct: 95 GFFYAL 100 >At5g37600.1 68418.m04529 glutamine synthetase, putative similar to glutamine synthetase, cytosolic isozyme (Glutamate-- ammonia ligase, GS1) [Lotus japonicus] SWISS-PROT:Q42899 Length = 356 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 422 HVGQNLNLINQLVTNPGQLRYSVGPALGCAGGGRIY 529 + G N++ IN V PGQ + VGPA+G + I+ Sbjct: 181 YAGINISGINGEVM-PGQWEFQVGPAVGISAADEIW 215 >At3g12200.1 68416.m01521 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 571 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 291 LSPIYLPVSPVMPV 332 LSPIYLPV P+ PV Sbjct: 283 LSPIYLPVFPIKPV 296 >At5g24350.1 68418.m02870 expressed protein weak similarity to neuroblastoma-amplified protein [Homo sapiens] GI:4337460 Length = 2376 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +3 Query: 330 VQPLTSLTLTQTASGPETSPASDNLSVPSSDTWDKT*ILSINSSLTLVNSDTLSDQPWVV 509 ++PL ++ + + P + +P S TW + IL IN + L +D + + Sbjct: 1726 LEPLQAVEILKRHFTLVLPPNGSYMHIPDSSTWQECLILLINFWIRL--ADEMQEVKSSN 1783 Query: 510 PEVEESMTSKP 542 P + E++T P Sbjct: 1784 PSLVENLTLSP 1794 >At4g23300.1 68417.m03358 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 660 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 265 CLTCIVALAGHVLQDLLNVEDGDAFVGVIDVVPCT*DYGT-SFSIINVAW 119 C CI AG ++QD +N DA+ +D C Y SFS W Sbjct: 88 CFNCIKGAAGWLIQDCVN--QTDAYYWALDPTLCLVRYSNISFSGSAAFW 135 >At4g00560.3 68417.m00079 methionine adenosyltransferase regulatory beta subunit-related contains weak similarity to methionine adenosyltransferase regulatory beta subunit (GI:6815285) [Homo sapiens] Length = 253 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = +3 Query: 264 HQRWPKPPELSPIYLPVSPVMPVQPLTSL---TLTQTASGPETSPASDNLSVPSSDTWDK 434 H P P L + P SP PV + L +++Q P+ LSVP + D Sbjct: 41 HHSSPLPARLLDAF-PHSPAFPVDLKSGLGLNSISQDFRQPDVVVNCAALSVPRACEQDP 99 Query: 435 T*ILSINSSLTLVN 476 +SIN +LVN Sbjct: 100 DSAMSINVPTSLVN 113 >At4g00560.2 68417.m00078 methionine adenosyltransferase regulatory beta subunit-related contains weak similarity to methionine adenosyltransferase regulatory beta subunit (GI:6815285) [Homo sapiens] Length = 201 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = +3 Query: 264 HQRWPKPPELSPIYLPVSPVMPVQPLTSL---TLTQTASGPETSPASDNLSVPSSDTWDK 434 H P P L + P SP PV + L +++Q P+ LSVP + D Sbjct: 41 HHSSPLPARLLDAF-PHSPAFPVDLKSGLGLNSISQDFRQPDVVVNCAALSVPRACEQDP 99 Query: 435 T*ILSINSSLTLVN 476 +SIN +LVN Sbjct: 100 DSAMSINVPTSLVN 113 >At4g00560.1 68417.m00077 methionine adenosyltransferase regulatory beta subunit-related contains weak similarity to methionine adenosyltransferase regulatory beta subunit (GI:6815285) [Homo sapiens] Length = 327 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = +3 Query: 264 HQRWPKPPELSPIYLPVSPVMPVQPLTSL---TLTQTASGPETSPASDNLSVPSSDTWDK 434 H P P L + P SP PV + L +++Q P+ LSVP + D Sbjct: 41 HHSSPLPARLLDAF-PHSPAFPVDLKSGLGLNSISQDFRQPDVVVNCAALSVPRACEQDP 99 Query: 435 T*ILSINSSLTLVN 476 +SIN +LVN Sbjct: 100 DSAMSINVPTSLVN 113 >At3g23530.1 68416.m02961 cyclopropane fatty acid synthase, putative / CPA-FA synthase, putative similar to cyclopropane synthase [Sterculia foetida] GI:21069167; contains Pfam profiles PF02353: Cyclopropane-fatty-acyl-phospholipid synthase, PF01593: amine oxidase, flavin-containing Length = 867 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +2 Query: 101 YSDNEIPRDIDDGKASSVISRAWDYVDDTDKSIAILNVQEILKDMASQGD 250 YSD + DID + AW+++ T+K + + IL+++ + Sbjct: 297 YSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSE 346 >At3g23510.1 68416.m02960 cyclopropane fatty acid synthase, putative / CPA-FA synthase, putative similar to cyclopropane synthase [Sterculia foetida] GI:21069167; contains Pfam profile PF02353: Cyclopropane-fatty-acyl-phospholipid synthase Length = 867 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +2 Query: 101 YSDNEIPRDIDDGKASSVISRAWDYVDDTDKSIAILNVQEILKDMASQGD 250 YSD + DID + AW+++ T+K + + IL+++ + Sbjct: 297 YSDIYLHHDIDLMPRNKAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSE 346 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 484 VSELTRVSDELIDKIQVLSHVSEEGTERLSEA-GEVSGPDAVCVRVN 347 +SE +DKI L+ S E RL+EA E++ A+C R++ Sbjct: 138 ISEKNSTIKSYLDKIVKLTDTSSEKEARLAEATAELARSQAMCSRLS 184 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,713,233 Number of Sequences: 28952 Number of extensions: 310701 Number of successful extensions: 1236 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1232 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -