BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30062 (347 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 5.5 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 5.5 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 5.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 20 9.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 9.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 9.6 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 5.5 Identities = 10/38 (26%), Positives = 16/38 (42%) Frame = +3 Query: 39 IQGTKPHLGIIGPLAINVNNVPVRFQQTQAPSKDKYGP 152 IQ P IGP + +P + + P ++GP Sbjct: 134 IQEQIPRFRHIGPSTLFPRFIPPNAYRLRPPLNPRFGP 171 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 20.6 bits (41), Expect = 5.5 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 39 IQGTKPHLGIIGPLAINVNNVPVRFQQTQAPSKDKYGP 152 IQ P IGPL +P + + P ++GP Sbjct: 138 IQEQIPRFRHIGPLTPFPRFIPPNAYRFRPPLNPRFGP 175 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.6 bits (41), Expect = 5.5 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 39 IQGTKPHLGIIGPLAINVNNVPVRFQQTQAPSKDKYGP 152 IQ P IGPL +P + + P ++GP Sbjct: 379 IQEQIPRFRHIGPLTPFPRFIPPNAYRFRPPLNPRFGP 416 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 19.8 bits (39), Expect = 9.6 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -3 Query: 345 TSFLLANLLLPCL 307 T F NL++PC+ Sbjct: 240 TLFYTVNLIIPCM 252 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 19.8 bits (39), Expect = 9.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 184 KFVKTRSLSASGPYLSFEGAWVC 116 KFV + L+ P+ S W+C Sbjct: 513 KFVPVKYLTYEYPWWSHVLGWLC 535 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 19.8 bits (39), Expect = 9.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 184 KFVKTRSLSASGPYLSFEGAWVC 116 KFV + L+ P+ S W+C Sbjct: 566 KFVPVKYLTYEYPWWSHVLGWLC 588 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,250 Number of Sequences: 438 Number of extensions: 2362 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7936320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -