BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30056 (665 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.03c |tim10||Tim9-Tim10 complex subunit Tim10|Schizosacch... 30 0.34 SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe... 30 0.34 SPBC29A3.06 |||CGI-48 family|Schizosaccharomyces pombe|chr 2|||M... 29 0.80 SPBC146.10 |mug57||meiotically upregulated gene Mug57|Schizosacc... 28 1.4 SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|... 27 2.4 SPCC16A11.04 |snx12||sorting nexin Snx12 |Schizosaccharomyces po... 27 2.4 SPAC806.02c |||Par A family ATPase iron cluster assembly protein... 27 3.2 SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch... 25 7.4 SPAC8F11.03 |msh3|swi4|MutS protein homolog 3|Schizosaccharomyce... 25 7.4 SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein ... 25 9.8 SPAC1565.02c |||GTPase activating protein|Schizosaccharomyces po... 25 9.8 SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos... 25 9.8 >SPAC222.03c |tim10||Tim9-Tim10 complex subunit Tim10|Schizosaccharomyces pombe|chr 1|||Manual Length = 89 Score = 29.9 bits (64), Expect = 0.34 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 214 IDHNLITRNHDKCRVSEFYDNVRTLKTVLTVD-CPWLNFESNRTLAQHM 357 I + L+ H KC ++Y+ T + +D C FE+N++L+QHM Sbjct: 31 IFNRLVMTCHKKCISPKYYEADLTKGESVCIDRCVSKYFEANQSLSQHM 79 >SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 721 Score = 29.9 bits (64), Expect = 0.34 Identities = 25/91 (27%), Positives = 36/91 (39%), Gaps = 3/91 (3%) Frame = +1 Query: 106 DHLAANSKCIPGRGQIPSQYEIPVFQFEIPYFNATYIDHNLITRNHDKCRVSEFY--DNV 279 + + + +K I G S Y + +FQ + P F + HD C VS Y D Sbjct: 186 ERILSEAKRISWGGSQSSSYLLKLFQIKYPSFPIKMLPSQAELLMHDHCHVSSDYTHDIA 245 Query: 280 RTL-KTVLTVDCPWLNFESNRTLAQHMSFKE 369 L + +L D L F AQ S +E Sbjct: 246 HALDRDILERDEIVLQFPYTEAAAQEKSQEE 276 >SPBC29A3.06 |||CGI-48 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 556 Score = 28.7 bits (61), Expect = 0.80 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 234 GNEIMVDVGGVEVWYFKLEHRYLVLR 157 G+E++V G EVW+F +E R +V R Sbjct: 361 GSEMLVLSYGAEVWHFNVEQRSVVRR 386 >SPBC146.10 |mug57||meiotically upregulated gene Mug57|Schizosaccharomyces pombe|chr 2|||Manual Length = 189 Score = 27.9 bits (59), Expect = 1.4 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -3 Query: 369 FLERHVLSQGPIGFKVQPRTVDG 301 F+ERH+++ PI + + +T+DG Sbjct: 122 FVERHIITSSPIEWNNEYKTIDG 144 >SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1402 Score = 27.1 bits (57), Expect = 2.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 58 SPIYRPCFLDDYKCISDHLAANSKCIPGRGQIPS 159 +P Y P FL+ SD + + +P RG I S Sbjct: 1362 TPSYTPSFLEGSPVFSDEILNRGEYMPHRGSISS 1395 >SPCC16A11.04 |snx12||sorting nexin Snx12 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1010 Score = 27.1 bits (57), Expect = 2.4 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +1 Query: 430 FDKGNNFDLCSAFTFADLAGGLPIFHI---NPNDQRTAQWLSKDLTLLHIYEREHIFG 594 F+ N+F+ + T + +G + F + +PND QWL K T + I E+ +FG Sbjct: 837 FEVNNSFNASNVNTNSSFSGPISEFLVELFSPNDDAKQQWLPKK-TYISILEQ--LFG 891 >SPAC806.02c |||Par A family ATPase iron cluster assembly protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 608 Score = 26.6 bits (56), Expect = 3.2 Identities = 15/70 (21%), Positives = 32/70 (45%) Frame = +1 Query: 421 TTVFDKGNNFDLCSAFTFADLAGGLPIFHINPNDQRTAQWLSKDLTLLHIYEREHIFGKR 600 T +F G L + L G +PI +P + L+ D ++H+Y + + K Sbjct: 208 TNIFSSGGGLTLSEKYKLPFL-GSVPI---DPKFGEMIENLTPDSNIVHLYSKTEMSKKF 263 Query: 601 NWLARSFISR 630 +++ F+++ Sbjct: 264 SFITNEFLNQ 273 >SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.4 bits (53), Expect = 7.4 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +1 Query: 157 SQYEIPVFQFEIPYFN--ATYIDHNLITRNHDKCRVSEF 267 S Y + + +F F+ +T D NL +RN DK + F Sbjct: 209 SNYSVSIVEFSRGQFHIKSTVCDRNLGSRNMDKALIDYF 247 >SPAC8F11.03 |msh3|swi4|MutS protein homolog 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1004 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = +1 Query: 253 RVSEFYDNVRTLKTVL-TVDC 312 R+SE Y+ +R + TVL T+DC Sbjct: 690 RISEHYNELRNVTTVLGTLDC 710 >SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein S0B|Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 25.0 bits (52), Expect = 9.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 71 GPASWTITNASPTTW 115 G A W IT A+P+ W Sbjct: 272 GDAEWNITGAAPSEW 286 >SPAC1565.02c |||GTPase activating protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 374 Score = 25.0 bits (52), Expect = 9.8 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = -1 Query: 665 VAQWWQPKSQSV----LLMKDLASQFLFPKMCSLS*MCSRVRSLDNHCAV 528 V QW +P V ++ K L ++ LF K CS + + DN C V Sbjct: 172 VQQWTRPPDALVEGMQVVSKSLQTEGLFRKSCSRKHLDIVIELYDNGCMV 221 >SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 2|||Manual Length = 473 Score = 25.0 bits (52), Expect = 9.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 108 PPGRELEMYPGQRADPLAVRDTGVPV 185 PP + YP PLA++ G P+ Sbjct: 407 PPQAQFSPYPAVAPSPLALQTRGAPI 432 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,712,842 Number of Sequences: 5004 Number of extensions: 56097 Number of successful extensions: 184 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -