BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30054 (626 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 23 2.1 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 22 3.7 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 6.4 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 6.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.4 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 348 KLAFVIRIRGINQVSPKVRKVLQL 419 KL FV+R+ GI + +RK ++L Sbjct: 359 KLWFVLRLYGIENLQAFIRKHVEL 382 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 574 LSLANPRLYTNSRTLF 527 LS A PRL N+RT+F Sbjct: 87 LSSAFPRLKRNARTIF 102 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/44 (22%), Positives = 20/44 (45%) Frame = +3 Query: 183 LQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRPARQAR 314 + + R A +K+R K+A + + EY P+ +A+ Sbjct: 220 VMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAK 263 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 195 LKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRP 299 L ++ K E+ KRA+ EYR +RP Sbjct: 259 LTNKNLVSKPPHEVEKRAQDGQYEYRSLSHVSLRP 293 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 8.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 103 KTVRSCLLYQSQCSSIVRGERLFALG 180 K V C L +S + + G R ALG Sbjct: 496 KVVAECTLKESAAINQILGRRWHALG 521 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 8.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 103 KTVRSCLLYQSQCSSIVRGERLFALG 180 K V C L +S + + G R ALG Sbjct: 388 KVVAECTLKESAAINQILGRRWHALG 413 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,909 Number of Sequences: 336 Number of extensions: 2919 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -