BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30053 (490 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 25 0.57 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 1.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 1.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 3.1 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 3.1 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 4.0 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 21 7.0 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 21 7.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 7.0 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 7.0 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 7.0 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 7.0 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 7.0 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 7.0 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 7.0 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 7.0 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 7.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 7.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 7.0 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 7.0 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 9.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 9.3 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.6 bits (51), Expect = 0.57 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 428 SYKDILINKNNYKKKFSKINSYHMITV 348 +Y + N NNYKK + IN I + Sbjct: 312 NYSNNYYNNNNYKKLYYNINYIEQIPI 338 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 1.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = -2 Query: 300 VFNSMLR-GLPANNHVTNHSRDQRLIICANVQSYT--FAIKE 184 V+N + R PA ++T ++ Q I AN+ SYT A+KE Sbjct: 40 VYNLLYRVAQPALANITWYNEGQAWNIEANIDSYTNAAAVKE 81 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 1.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = -2 Query: 300 VFNSMLR-GLPANNHVTNHSRDQRLIICANVQSYT--FAIKE 184 V+N + R PA ++T ++ Q I AN+ SYT A+KE Sbjct: 40 VYNLLYRVAQPALANITWYNEGQAWNIEANIDSYTNAAAVKE 81 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 3.1 Identities = 5/19 (26%), Positives = 13/19 (68%) Frame = +3 Query: 321 FSQKNHTEYYCNHMVRIYF 377 ++ N+ + YCN+ ++Y+ Sbjct: 91 YNNNNYKKLYCNNYKKLYY 109 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 3.1 Identities = 5/19 (26%), Positives = 13/19 (68%) Frame = +3 Query: 321 FSQKNHTEYYCNHMVRIYF 377 ++ N+ + YCN+ ++Y+ Sbjct: 91 YNNNNYKKLYCNNYKKLYY 109 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 4.0 Identities = 5/19 (26%), Positives = 13/19 (68%) Frame = +3 Query: 321 FSQKNHTEYYCNHMVRIYF 377 ++ N+ + YCN+ ++Y+ Sbjct: 91 YNNNNYKKLYCNNYRKLYY 109 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 411 QNVFITFLMLNYKVTRVVIEL 473 QN+F N K+TR +I + Sbjct: 60 QNIFKIIKSTNEKITRYIIRM 80 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 411 QNVFITFLMLNYKVTRVVIEL 473 QN+F N K+TR +I + Sbjct: 43 QNIFKIIKSTNEKITRYIIRM 63 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 102 NKHNYNKLYYNINYIEQIPI 121 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 335 NKHNYNKLYYNINYIEQIPI 354 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 407 NKNNYKKKFSKINSYHMITV 348 NK+NY K + IN I + Sbjct: 335 NKHNYNKLYYNINYIEQIPI 354 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 7.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 401 NNYKKKFSKINSYHMITV 348 NNYKK + IN I V Sbjct: 346 NNYKKLYYNINYIEQIPV 363 Score = 20.6 bits (41), Expect = 9.3 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -3 Query: 407 NKNNYKKKFSKINSYH 360 N NNY ++ N+Y+ Sbjct: 326 NYNNYNNNYNNYNNYN 341 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 20.6 bits (41), Expect = 9.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 360 YDYSSIPYGFSGKM 319 + YSS PYGF ++ Sbjct: 589 FKYSSQPYGFPERL 602 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 20.6 bits (41), Expect = 9.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 360 YDYSSIPYGFSGKM 319 + YSS PYGF ++ Sbjct: 589 FKYSSQPYGFPERL 602 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,796 Number of Sequences: 438 Number of extensions: 2401 Number of successful extensions: 23 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -