BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30052 (606 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006790-13|AAF60737.2| 351|Caenorhabditis elegans Serpentine r... 27 7.9 >AC006790-13|AAF60737.2| 351|Caenorhabditis elegans Serpentine receptor, class z protein5 protein. Length = 351 Score = 27.5 bits (58), Expect = 7.9 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +3 Query: 21 RLRKRNSLTICSRDVAALPYIPTRAVNFID-GSNFYIFILCNFLVIVDFCFYYII*KKSV 197 RL ++TIC P+I V ID G ++ + C L +++F ++ + S Sbjct: 247 RLIMYQAITICVSKFVTFPFIVFNGVMIIDQGYYGFLKLACIMLSVINFATTPLLIQISY 306 Query: 198 IFRCRKYYSIIREVRLRF 251 I+ C K I + L F Sbjct: 307 IY-CNKRNVKIMQSLLTF 323 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,381,900 Number of Sequences: 27780 Number of extensions: 197792 Number of successful extensions: 411 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1300523034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -