BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30051 (620 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1E8.02 |||ubiquitin family protein, unknown|Schizosaccharomy... 31 0.18 SPBC428.10 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 28 1.3 SPAC15A10.15 |sgo2||shugoshin Sgo2|Schizosaccharomyces pombe|chr... 27 1.7 SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosa... 26 3.8 SPBC30D10.04 |swi3||replication fork protection complex subunit ... 26 5.1 SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosa... 25 6.7 >SPBC1E8.02 |||ubiquitin family protein, unknown|Schizosaccharomyces pombe|chr 2|||Manual Length = 603 Score = 30.7 bits (66), Expect = 0.18 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +2 Query: 512 LFCHVPSGFGVSSPTTVFFSSAMTCAFLLLTWALAP 619 LFC V + + VS T+ +S M+ FLL T ALAP Sbjct: 481 LFC-VLTTYNVSLSQTILLTSIMSVVFLLQTGALAP 515 >SPBC428.10 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 751 Score = 27.9 bits (59), Expect = 1.3 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -2 Query: 613 QSPS*KKEGTCHSAREKYCSRGAHSKARWYVAKKISENALWTNVTVP 473 +SP G +S R KY S G +SKA+ Y AK+ S + +++ P Sbjct: 429 RSPKAGSAGKENSWRSKYLSEGKNSKAK-YTAKQPSYDRAGSSLASP 474 >SPAC15A10.15 |sgo2||shugoshin Sgo2|Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 27.5 bits (58), Expect = 1.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 600 RRRKAHVIAL-EKNTVVGELTPKPDGTWQKRSLKTH 496 RRRKA + E++TVV E KPDG ++ K + Sbjct: 546 RRRKARIQETSEESTVVNEPNEKPDGRSRRERKKVN 581 >SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1029 Score = 26.2 bits (55), Expect = 3.8 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 469 YLELLHSSTVRFQRSFLPRTIW-LWSELPYYSIFLERYDM 585 Y+ L+ ++ RSF R W ++SE P Y +F +++D+ Sbjct: 443 YISLVETNEGSLTRSF-SRFSWDMFSESPVYQLFHKKFDV 481 >SPBC30D10.04 |swi3||replication fork protection complex subunit Swi3|Schizosaccharomyces pombe|chr 2|||Manual Length = 181 Score = 25.8 bits (54), Expect = 5.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 465 WINSTPVAGGXMANASLFT 409 WIN V G +NASLFT Sbjct: 128 WINEIAVENGSDSNASLFT 146 >SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 466 Score = 25.4 bits (53), Expect = 6.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 283 YSKKNINKDKQFLIYSQFDNRRQEQK 206 + KK D+QFL Y DN R E K Sbjct: 200 FKKKKNWSDEQFLQYVWSDNHRDEMK 225 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,456,637 Number of Sequences: 5004 Number of extensions: 48150 Number of successful extensions: 129 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -