BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30051 (620 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 31 0.030 AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 prot... 26 1.1 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 25 2.6 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 25 2.6 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 23 7.8 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 31.1 bits (67), Expect = 0.030 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 343 KFXHYYDCILXFYKHKFRQXYSKKNINKDKQFLIYSQFDNRRQEQ 209 K YY Y H F+ +S+ N N Q Y QF N+ QE+ Sbjct: 965 KSSDYYYKYYKQYPHLFKDYFSQYNKNHKYQNDYYEQFGNKNQEE 1009 >AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 protein. Length = 250 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 457 VNPYYLELLHSSTVRFQRSFLPRTIWLWSE 546 +NP ++ S+ RF S LP + WS+ Sbjct: 124 INPAIIDSFASAAFRFGHSLLPTAVERWSK 153 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 24.6 bits (51), Expect = 2.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 585 HVIALEKNTVVGELTPKPD 529 H L+KN V G P PD Sbjct: 94 HTTGLQKNMVAGHFVPYPD 112 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 24.6 bits (51), Expect = 2.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 585 HVIALEKNTVVGELTPKPD 529 H L+KN V G P PD Sbjct: 94 HTTGLQKNMVAGHFVPYPD 112 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 571 ERYDMCLPSSNLGSG 615 ++YD C+PS G G Sbjct: 105 DKYDRCIPSYRCGKG 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 634,349 Number of Sequences: 2352 Number of extensions: 13545 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -