BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30051 (620 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74810.1 68414.m08667 anion exchange family protein contains ... 31 0.81 At1g15460.1 68414.m01858 anion exchange family protein member of... 29 1.9 >At1g74810.1 68414.m08667 anion exchange family protein contains Pfam profile: PF00955 Anion exchanger family Length = 683 Score = 30.7 bits (66), Expect = 0.81 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 488 RPQCVFRDLFCHVPSGFGVSSPTT-VFFSSAM 580 R C +D + SGFG+ +PTT VFF+SA+ Sbjct: 23 RALCYKQDWIAGLRSGFGILAPTTYVFFASAL 54 >At1g15460.1 68414.m01858 anion exchange family protein member of the PF|00955 Anion exchanger family Length = 683 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 488 RPQCVFRDLFCHVPSGFGVSSPTT-VFFSSAM 580 R C D + SGFG+ +PTT +FF+SA+ Sbjct: 23 RALCYKEDWVAGLRSGFGILAPTTYIFFASAL 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,539,791 Number of Sequences: 28952 Number of extensions: 235544 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -