BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30050 (410 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 25 1.4 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 22 7.6 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 24.6 bits (51), Expect = 1.4 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 285 IDQDSNEFLN-VXILVEKIYNGYGLTDLNTDIE 380 ID ++NE ++ I E + GYGLT + D++ Sbjct: 156 IDLNTNEPIHRFEIPKEAVETGYGLTSITLDVD 188 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 22.2 bits (45), Expect = 7.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 381 FLCQYSNQLTRSHCRFFQQEXRHSRIH*NPG 289 +L ++ + R RF Q++ R SRI +PG Sbjct: 673 YLLDQASYIRRIAKRFGQEDARPSRIPMDPG 703 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 259,241 Number of Sequences: 2352 Number of extensions: 4356 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33349914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -