BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30049 (386 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.32 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 2.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 2.9 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 3.9 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 22 6.8 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 22 9.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 22 9.0 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 110 PASWTITNASPTTWPRTRNVSRAEGRSPRSTR 205 PA + PT+WPR+R S+ + R PR R Sbjct: 275 PARRRSRSTRPTSWPRSRPTSKPK-RLPRRRR 305 Score = 23.0 bits (47), Expect = 3.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 89 RRVRSTGPASWTITNASPTTWPR 157 RR RST P SW + PT+ P+ Sbjct: 278 RRSRSTRPTSW--PRSRPTSKPK 298 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.8 bits (49), Expect = 2.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 110 PASWTITNASPTTWPRTRNVSRAE 181 P SW +++ +PTT P V E Sbjct: 469 PVSWPVSSDAPTTVPSDSRVEPQE 492 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 2.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 130 KCISDHLAANSKCIPGRGQIP 192 KC + NS+C+P +G P Sbjct: 279 KCPKGKMPQNSECVPCKGVCP 299 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.0 bits (47), Expect = 3.9 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 88 PPSPIYRPCFLDDYK-CISDHLAANSKCIPG 177 P + +Y C K CIS+ + + C+PG Sbjct: 27 PKNEVYSCCAPCPQKACISEAVKCQTSCLPG 57 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = -3 Query: 345 VDG*NCF*SSHIVIKFADTAFVVVTGNEIMVDV 247 ++G N SHI+ FA+ ++ N+ ++D+ Sbjct: 1038 LNGINAGKRSHILSLFANYVIHIIGNNDAVIDI 1070 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 21.8 bits (44), Expect = 9.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 159 VRGQVVGDAFVIVQEAGPVDRTRRPCRSQNCHSG 58 VRG VGD + + G V+ +R R+ N +G Sbjct: 4 VRGFSVGDELGLAESLGNVEANKR--RALNIRTG 35 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.8 bits (44), Expect = 9.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 229 VFQTGTPVSRTARGSALCPGYISSSRPGGRR 137 +++ TP + T ++L P SSR G R Sbjct: 666 IYRRTTPTTTTTTTASLAPAPAISSRFGDNR 696 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 393,840 Number of Sequences: 2352 Number of extensions: 8239 Number of successful extensions: 52 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29929410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -