BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30049 (386 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 24 0.53 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 24 0.53 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 1.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 2.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 2.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 2.8 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 3.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 3.7 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 4.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 6.5 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 24.2 bits (50), Expect = 0.53 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 232 YFNATYIDHNLITRNHDKCRVSEFYDNVRTLK 327 YF+ TYI + + H+K ++E + TL+ Sbjct: 39 YFHHTYIIYESLCGRHEKRLLNELLSSYNTLE 70 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 24.2 bits (50), Expect = 0.53 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 232 YFNATYIDHNLITRNHDKCRVSEFYDNVRTLK 327 YF+ TYI + + H+K ++E + TL+ Sbjct: 39 YFHHTYIIYESLCGRHEKRLLNELLSSYNTLE 70 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 22.6 bits (46), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 152 PRTRNVSRAEGRSPRST 202 PRTR V R++GR T Sbjct: 1 PRTRRVKRSDGRGNGGT 17 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 2.8 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -3 Query: 135 AFVIVQEAGPVDRTRRPCRSQNCHSGY 55 A +V ++ +++ ++CHSGY Sbjct: 474 AVAVVSKSSSINKLEDLRNKKSCHSGY 500 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 2.8 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -3 Query: 135 AFVIVQEAGPVDRTRRPCRSQNCHSGY 55 A +V ++ +++ ++CHSGY Sbjct: 474 AVAVVSKSSSINKLEDLRNKKSCHSGY 500 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 2.8 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -3 Query: 135 AFVIVQEAGPVDRTRRPCRSQNCHSGY 55 A +V ++ +++ ++CHSGY Sbjct: 474 AVAVVSKSSSINKLEDLRNKKSCHSGY 500 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.4 bits (43), Expect = 3.7 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = -3 Query: 306 IKFADTAFVVVTGNEIMVDVGGVEVWYFKLEHRYLVLRGD 187 +KF+ F+V+ + M+D+G + ++H +V G+ Sbjct: 343 VKFSSVQFLVLDEADRMLDMGFLPSIEKMVDHETMVPLGE 382 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 3.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 214 TPVSRTARGSALCPGYISSSRPGGR 140 TPV R A+ S+ Y S GGR Sbjct: 1339 TPVPRLAQDSSEDESYRGPSASGGR 1363 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 4.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 131 NASPTTW 151 NASPTTW Sbjct: 514 NASPTTW 520 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 105 VDRTRRPCRSQNCHS 61 V TRRP R +C S Sbjct: 398 VGSTRRPSRRNSCES 412 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,349 Number of Sequences: 438 Number of extensions: 2261 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9391092 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -