BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30044 (454 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 77 5e-15 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_54474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) 27 7.3 SB_35862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_13074| Best HMM Match : Fz (HMM E-Value=5.3e-17) 27 9.6 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 77.4 bits (182), Expect = 5e-15 Identities = 47/79 (59%), Positives = 54/79 (68%), Gaps = 1/79 (1%) Frame = +1 Query: 19 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKHGYIGEFEIVDDHRAGK 198 MVR+NVL+DAL SI NAEKRGKRQV IRP SKVIVKFLTVMMKH V R G+ Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMKH--------VAQPRIGE 52 Query: 199 IVVN-LTGRLNKCGVISPR 252 +V +G L+ GV+ R Sbjct: 53 MVTRPCSGALSAAGVVVTR 71 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 50.0 bits (114), Expect = 9e-07 Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 1/28 (3%) Frame = +1 Query: 232 CGVISPRFDVPINDIERW-TNLLPSRQF 312 CGVISPRFDV + DIE+W +NLLPSRQF Sbjct: 1 CGVISPRFDVGVRDIEQWASNLLPSRQF 28 >SB_54474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 28.7 bits (61), Expect = 2.4 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 52 KSIHNAEKRGKRQVLIRPCSKVIVKFL--TVMMKHGYIGEFEIV 177 K+IHN RGKR +++ V F TV+M++G F++V Sbjct: 17 KNIHNVNVRGKRGNIVQVYPAVEYDFTPNTVLMRNGDYVHFQLV 60 >SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) Length = 549 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 241 ISPRFDVPINDIERWTNLLPSRQFGYL 321 ISP F VP D ++ ++L+PS+Q +L Sbjct: 381 ISPIFTVPKKDGKKKSSLIPSQQITFL 407 >SB_35862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 26.6 bits (56), Expect = 9.6 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 350 SMMPPLVVRTR*PNCREGSRLVHLSISLMGTSKRGEMT 237 S + PL++ TR PN RE R+V + + G+ G +T Sbjct: 277 SALDPLILATRLPNIREAVRIV---LGIRGSRVGGAIT 311 >SB_13074| Best HMM Match : Fz (HMM E-Value=5.3e-17) Length = 377 Score = 26.6 bits (56), Expect = 9.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 380 QGVFFLASSWSMMPPLVVRTR*PNCREGS 294 +G+ FL W ++ P + + P C+ GS Sbjct: 84 EGLKFLPKCWEVLQPFLCQIYKPKCKNGS 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,996,449 Number of Sequences: 59808 Number of extensions: 227382 Number of successful extensions: 1122 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 908427626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -