BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30041 (346 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39848-1|AAT81210.1| 1338|Caenorhabditis elegans Latrophilin rec... 26 6.3 AY314772-1|AAQ84879.1| 1338|Caenorhabditis elegans latrophilin-l... 26 6.3 L16685-3|AAA28169.3| 321|Caenorhabditis elegans Hypothetical pr... 26 8.3 >U39848-1|AAT81210.1| 1338|Caenorhabditis elegans Latrophilin receptor protein 2 protein. Length = 1338 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 122 TSDYANCNFAGLTFITRCYSFTVEVNRE 39 T+ +C + F +RCYS T+E N + Sbjct: 324 TAQQPSCLSGLIQFDSRCYSMTIETNEK 351 >AY314772-1|AAQ84879.1| 1338|Caenorhabditis elegans latrophilin-like protein LAT-2 protein. Length = 1338 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 122 TSDYANCNFAGLTFITRCYSFTVEVNRE 39 T+ +C + F +RCYS T+E N + Sbjct: 324 TAQQPSCLSGLIQFDSRCYSMTIETNEK 351 >L16685-3|AAA28169.3| 321|Caenorhabditis elegans Hypothetical protein ZC21.3 protein. Length = 321 Score = 25.8 bits (54), Expect = 8.3 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 215 PHPSNRNALLLHGRNRQGGGTYPRGLTRGPTTSDYAN 105 P SN+N +L N QG +G+ TT Y N Sbjct: 164 PQSSNQNQVLRDQSNNQGYMNNNQGMYNTQTTQGYGN 200 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,617,068 Number of Sequences: 27780 Number of extensions: 169265 Number of successful extensions: 313 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 451081596 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -