BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30037 (585 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.4 AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical prote... 23 5.5 AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosens... 23 5.5 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 7.3 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 7.3 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 2.4 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = +3 Query: 87 LQKDH*INLGFIEIIIDKMSKLIPSAAKFLAGNTITKVTAPVVATNAKYSTKKEATFEIK 266 LQK + +GF +I+ LI +A I + TA + N +ST++ + F +K Sbjct: 2993 LQKGF-LTVGFYSLIVSLRMSLISESA-------IPEFTAAEASINVLFSTEQFSDFIVK 3044 Query: 267 P 269 P Sbjct: 3045 P 3045 >AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical protein protein. Length = 168 Score = 23.4 bits (48), Expect = 5.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 197 SDCTGCSDKRKIQHEK 244 SDC CS+K++I +K Sbjct: 72 SDCVKCSEKQRIGSDK 87 >AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosensory protein CSP3 protein. Length = 168 Score = 23.4 bits (48), Expect = 5.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 197 SDCTGCSDKRKIQHEK 244 SDC CS+K++I +K Sbjct: 72 SDCVKCSEKQRIGSDK 87 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 578 GPAPRQLREHPQHTNAHEI 522 GP P Q H QH + H++ Sbjct: 85 GPMPAQPPHHHQHPHHHQL 103 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 578 GPAPRQLREHPQHTNAHEI 522 GP P Q H QH + H++ Sbjct: 85 GPMPAQPPHHHQHPHHHQL 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,022 Number of Sequences: 2352 Number of extensions: 11530 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -