BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30036 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAP27G11.12 |||human down-regulated in multiple cancers-1 homol... 30 0.29 SPBC32H8.07 |git5|gpb1|heterotrimeric G protein beta subunit Git... 28 1.5 SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 27 2.0 SPBC354.03 |swd3||WD repeat protein Swd3|Schizosaccharomyces pom... 27 2.0 SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharom... 27 2.7 SPAC29E6.03c |uso1|SPAC30.07c|ER to Golgi tethering factor Uso1 ... 26 4.7 SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces po... 26 6.2 >SPAP27G11.12 |||human down-regulated in multiple cancers-1 homolog 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 797 Score = 30.3 bits (65), Expect = 0.29 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 341 LNNKLVH*MLVKSCLALSLPSLHEALARHLPCYNGTKSETFTQP 210 L+N + H L++ C ++ L + E PCYN +S T P Sbjct: 253 LDNSVAHMSLIEYCFSVLLILMSEENNNGTPCYNNYRSSKNTLP 296 >SPBC32H8.07 |git5|gpb1|heterotrimeric G protein beta subunit Git5|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 27.9 bits (59), Expect = 1.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 2 GMAVATGSWDSFLRIWN 52 G +ATGSWD +R+W+ Sbjct: 286 GTMLATGSWDECVRLWS 302 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 27.5 bits (58), Expect = 2.0 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -2 Query: 310 SNRASLCRYHRS-TRHSRATYRATTVLSQKHSRSRPQLYKASTQSA 176 S+R+S R+ S +RH Y + S +HSRSR + + S++S+ Sbjct: 154 SSRSSRSRHPSSRSRHRYDDYSRSPPYSSRHSRSRRRYEERSSRSS 199 >SPBC354.03 |swd3||WD repeat protein Swd3|Schizosaccharomyces pombe|chr 2|||Manual Length = 380 Score = 27.5 bits (58), Expect = 2.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 2 GMAVATGSWDSFLRIWN 52 G + +GSWD +RIWN Sbjct: 150 GTLLVSGSWDETVRIWN 166 >SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 854 Score = 27.1 bits (57), Expect = 2.7 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 2 GMAVATGSWDSFLRIWN 52 G +A+GSWD +RIW+ Sbjct: 479 GSLLASGSWDKTVRIWD 495 >SPAC29E6.03c |uso1|SPAC30.07c|ER to Golgi tethering factor Uso1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1044 Score = 26.2 bits (55), Expect = 4.7 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 112 SNIDPSIYVYL*KLMSVCSSCTPIELKLCIVVDGCVNVSDLVPL 243 S+ D + +Y +L S SC P ELK C+ S +VPL Sbjct: 125 SHKDFYVRLYSVELFSAILSCRPTELKDCLQTFPSAISSIMVPL 168 >SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 25.8 bits (54), Expect = 6.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 11 VATGSWDSFLRIW 49 + TGSWDS R+W Sbjct: 112 IITGSWDSTARVW 124 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,673,454 Number of Sequences: 5004 Number of extensions: 50285 Number of successful extensions: 140 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -