BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30034 (606 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 22 4.6 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 8.1 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 8.1 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -3 Query: 367 DDVKSYTYFVNTSIGDWTTTNKFHHKIFNPTSQYNK 260 DD+ S Y + S D T +IF Q+N+ Sbjct: 180 DDILSQAYKLEASFDDLATYETDEVQIFIDVVQHNR 215 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 203 FVNVVNTTFATLKYVLAVEEEHL 135 FVN N +F +LKY + E + + Sbjct: 299 FVNRGNVSFNSLKYFVLDEADRM 321 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.0 bits (42), Expect = 8.1 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -2 Query: 431 MEGESMLHRP 402 M+G+ M+HRP Sbjct: 425 MDGQQMMHRP 434 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,365 Number of Sequences: 336 Number of extensions: 3223 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -